THAP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: THAP1 Antibody [NBP2-56308] - Staining of human cell line RH-30 shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYF
Specificity
Specificity of human THAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THAP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
THAP1 Recombinant Protein Antigen (NBP2-56308PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for THAP1 Antibody

  • 4833431A01Rik
  • dystonia 6, torsion (autosomal dominant)
  • DYT6
  • FLJ10477
  • MGC33014
  • nuclear proapoptotic factor
  • THAP domain containing, apoptosis associated protein 1
  • THAP domain protein 1
  • THAP domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, B/N
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NB100-98689
Species: Hu, Mu
Applications: WB, DB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-68210
Species: Hu, Mu
Applications: WB, Simple Western, IP
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
H00001876-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB100-74624
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for THAP1 Antibody (NBP2-56308) (0)

There are no publications for THAP1 Antibody (NBP2-56308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THAP1 Antibody (NBP2-56308) (0)

There are no reviews for THAP1 Antibody (NBP2-56308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for THAP1 Antibody (NBP2-56308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THAP1