Novus Biologicals products are now on bio-techne.com

TGIF1 Antibody

Images

 
Orthogonal Strategies: Western Blot: TGIF1 Antibody [NBP2-55829] - Analysis in human cell lines A-549 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western Blot: TGIF1 Antibody [NBP2-55829] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: TGIF1 Antibody [NBP2-55829] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TGIF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGIF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TGIF1 Recombinant Protein Antigen (NBP2-55829PEP)

Reactivity Notes

Mouse 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TGIF1 Antibody

  • 5'-TG-3' interacting factor
  • homeobox protein TGIF
  • homeobox protein TGIF1
  • HPE4
  • MGC39747
  • TALE homeobox TG-interacting factor
  • TGFB-induced factor (TALE family homeobox)
  • TGFB-induced factor homeobox 1
  • TGIF1
  • TGIFMGC5066,5'-TG-3'-interacting factor 1
  • transforming growth factor-beta-induced factor

Background

Novel homeobox gene, denoted TGIF (interacting factor), belongs to an expanding TALE (three amino acid loop extension) superclass of atypical homeodomains. The TGIF homeodomain binds to a previously characterized retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE), which contains an unusual DNA target for a homeobox (1). In vitro studies have implicated TGIF as a transcriptional repressor and corepressor in retinoid and TGF-beta signaling pathways that regulate several important biological processes. Heterozygous nonsense and missense mutations of the human TGIF gene have been associated with holoprosencephaly, the most common congenital malformation of the forebrain (2). It has been reported that TGIF plays an unexpected role in the inhibition of Smad2 phosphorylation, which occurs by a mechanism independent of its association with Smad2. This inhibitory function of TGIF is executed in concert with c-Jun, which facilitates the interaction of TGIF with cPML, resulting in the nuclear sequestration of cPML and the disruption of the cPML-SARA complex (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006496-M04
Species: Hu
Applications: ELISA, WB
NBP2-24607
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00060436-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-77306
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
294-HG
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
AF3635
Species: Mu
Applications: IHC, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB41051
Species: Hu, Mu
Applications: IHC, WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
AF4248
Species: Hu
Applications: ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
NBP2-55829
Species: Hu
Applications: WB, ICC/IF

Publications for TGIF1 Antibody (NBP2-55829) (0)

There are no publications for TGIF1 Antibody (NBP2-55829).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGIF1 Antibody (NBP2-55829) (0)

There are no reviews for TGIF1 Antibody (NBP2-55829). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TGIF1 Antibody (NBP2-55829) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TGIF1 Products

Research Areas for TGIF1 Antibody (NBP2-55829)

Find related products by research area.

Blogs on TGIF1

There are no specific blogs for TGIF1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TGIF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGIF1