TGF-beta RII Antibody (2M8Y2)

Western Blot: TGF-beta RII Antibody (2M8Y2) [NBP3-15679] - Western blot analysis of extracts of HepG2 cells, using TGF-beta RII (TGFBR2) antibody (NBP3-15679) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu
• Applications: WB
• Clone: 2M8Y2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TGF-beta RII Antibody (2M8Y2) Summary

• Description: Novus Biologicals Rabbit TGF-beta RII Antibody (2M8Y2) (NBP3-15679) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-130 of human TGF-beta RII (TGFBR2) (P37173). TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TGFBR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TGF-beta RII Antibody (2M8Y2)

• AAT3
• EC 2.7.11
• EC 2.7.11.30
• FAA3
• HNPCC6
• LDS1B
• LDS2B
• MFS2
• RIIC
• TAAD2
• tbetaR-II
• TGF-beta receptor type II
• TGF-beta receptor type IIB
• TGF-beta receptor type-2
• TGF-beta RII
• TGF-beta type II receptor
• TGFbetaRII
• TGFbeta-RII
• TGFBR2
• TGF-bRII
• TGFR-2
• transforming growth factor beta receptor type IIC
• transforming growth factor, beta receptor II (70/80kDa) isoform 1
• transforming growth factor, beta receptor II (70/80kDa) isoform 2
• transforming growth factor, beta receptor II (70/80kDa)
• transforming growth factor, beta receptor II (70-80kD)
• Transforming growth factor-beta receptor type II

Background

TGF beta Receptor II is a total of three members of the TGFbeta family, TGFbeta1, TGFbeta2 and TGFbeta3, have been identified in mammals. Each is synthesized as a latent precursor that is subsequently cleaved forming the 112 amino acid growth factor which becomes active upon dimerization. TGFbetas mediate their activity by high affinity binding to the type II receptor (TGFbeta RII) transmembrane protein with a cytoplasmic serine-threonine kinase domain. For signaling growth inhibition and early gene responses the type II receptor requires both its kinase activity and association with a TGFbeta-binding protein, designated the type I receptor. Two independent groups have recently described the cloning and sequence analysis of genes encoding TGFbeta type I receptor proteins designated ALK-5 (TbetaR-1) and TSR-1, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGFBR2