TGF-beta RII Antibody (2M8Y2) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 23-130 of human TGF-beta RII (TGFBR2) (P37173). TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPG |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
TGFBR2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TGF-beta RII Antibody (2M8Y2)
Background
TGF beta Receptor II is a total of three members of the TGFbeta family, TGFbeta1, TGFbeta2 and TGFbeta3, have been identified in mammals. Each is synthesized as a latent precursor that is subsequently cleaved forming the 112 amino acid growth factor which becomes active upon dimerization. TGFbetas mediate their activity by high affinity binding to the type II receptor (TGFbeta RII) transmembrane protein with a cytoplasmic serine-threonine kinase domain. For signaling growth inhibition and early gene responses the type II receptor requires both its kinase activity and association with a TGFbeta-binding protein, designated the type I receptor. Two independent groups have recently described the cloning and sequence analysis of genes encoding TGFbeta type I receptor proteins designated ALK-5 (TbetaR-1) and TSR-1, respectively.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu
Applications: WB
Publications for TGF-beta RII Antibody (NBP3-15679) (0)
There are no publications for TGF-beta RII Antibody (NBP3-15679).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TGF-beta RII Antibody (NBP3-15679) (0)
There are no reviews for TGF-beta RII Antibody (NBP3-15679).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TGF-beta RII Antibody (NBP3-15679) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TGF-beta RII Products
Research Areas for TGF-beta RII Antibody (NBP3-15679)
Find related products by research area.
|
Blogs on TGF-beta RII