TGF beta induced factor 2 Antibody

Western Blot: TGF beta induced factor 2 Antibody [H00060436-D01P] - Analysis of TGIF2 expression in transfected 293T cell line by TGIF2 polyclonal antibody.Lane 1: TGIF2 transfected lysate(25.90 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

TGF beta induced factor 2 Antibody Summary

• Immunogen: TGIF2 (NP_068581.1, 1 a.a. - 237 a.a.) full-length human protein. MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
• Specificity: TGIF2 - TGFB-induced factor 2 (TALE family homeobox),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGIF2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Reactivity Notes

Reacts with Tammar.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TGF beta induced factor 2 Antibody

• homeobox protein TGIF2
• TGF(beta)-induced transcription factor 2
• TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2
• TGFB-induced factor 2 (TALE family homeobox)
• TGFB-induced factor 2
• TGFB-induced factor homeobox 2
• transcription growth factor-beta-induced factor 2

Background

The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor. The encoded protein appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and overexpressed in some ovarian cancers, and mutations in this gene can cause holoprosencephaly. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TGF beta induced factor 2 Antibody (H00060436-D01P)(1)

Publication using H00060436-D01P

• Hu Y, Yu H, Shaw G et al. Differential roles of TGIF family genes in mammalian reproduction. BMC Dev Biol. 2011-09-29 [PMID: 21958027]

Bioinformatics

• Gene Symbol: TGIF2
• Entrez:
  • 60436(Human)
• Uniprot:
  • NP_068581.1(Human)