TGIF2LX Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TGIF2LX Antibody [NBP1-86320] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
Immunohistochemistry: TGIF2LX Antibody [NBP1-86320] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TGIF2LX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPN
Specificity
Specificity of human TGIF2LX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGIF2LX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TGIF2LX Protein (NBP1-86320PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TGIF2LX Antibody

  • homeobox protein TGIF2LX
  • MGC34726
  • TGF-beta-induced transcription factor 2-like protein
  • TGFB-induced factor 2-like protein, X-linked
  • TGFB-induced factor 2-like, X-linked
  • TGFB-induced factor homeobox 2-like, X-linked
  • TGIFLXTGIF-like on the X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00060436-M01
Species: Hu
Applications: WB, ELISA
MAB7555
Species: Hu
Applications: WB, Simple Western
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-92502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19672
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86320
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TGIF2LX Antibody (NBP1-86320) (0)

There are no publications for TGIF2LX Antibody (NBP1-86320).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGIF2LX Antibody (NBP1-86320) (0)

There are no reviews for TGIF2LX Antibody (NBP1-86320). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TGIF2LX Antibody (NBP1-86320) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TGIF2LX Antibody (NBP1-86320)

Discover related pathways, diseases and genes to TGIF2LX Antibody (NBP1-86320). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TGIF2LX Antibody (NBP1-86320)

Discover more about diseases related to TGIF2LX Antibody (NBP1-86320).
 

Pathways for TGIF2LX Antibody (NBP1-86320)

View related products by pathway.

Blogs on TGIF2LX

There are no specific blogs for TGIF2LX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TGIF2LX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGIF2LX