TGIF2LX Antibody - BSA Free

Analysis in control (vector only transfected HEK293T lysate) and TGIF2LX over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: TGIF2LX Antibody [NBP1-86320] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.

Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TGIF2LX Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGIF2LX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TGIF2LX Protein (NBP1-86320PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TGIF2LX Antibody - BSA Free

• homeobox protein TGIF2LX
• MGC34726
• TGF-beta-induced transcription factor 2-like protein
• TGFB-induced factor 2-like protein, X-linked
• TGFB-induced factor 2-like, X-linked
• TGFB-induced factor homeobox 2-like, X-linked
• TGIFLXTGIF-like on the X

Background

TGIF2LX encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGIF2LX