Recombinant TGF-beta 2 Protein

Product Discontinued

Recombinant TGF-beta 2 Protein Summary

• Description: A biologically reactive recombinant protein of Human TGF-beta 2.
  
  

  Source: Nicotiana benthamiana

  Amino Acid Sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS Molecular formula: C602 H909 N167 O171 S10 Extinction coefficient: E 0.1% 2.02 (A 280 nm) Molecular weight: recombinant human TGF-beta 2 is a 27.08 kDa protein composed of two identical 118 amino acid polypeptide chains linked by a single disulfide bond. p.I: 7.72 Purity: >97% as determined by SDS-PAGE gel. Endotoxin level: <0.04 EU/ìg protein (LAL method). It is recommended to add a carrier protein (0.1% HSA or BSA).

• Protein/Peptide Type: Recombinant Protein
• Gene: TGFB2

Applications/Dilutions

• Dilutions:
  • Bioactivity
  • SDS-Page
  • Western Blot
• Application Notes: This antibody can be tested using SDS-Page or Western Blot. Serological Identification: The protein was electrophoresed under reducing condition on a 15% SDS-polyacrylamide gel, transferred by electroblotting to a NC membrane and visualized by immune-detection with specific antibody TGF-beta 2 (reducing conditions ~13kDa monomer and ~26kDa homodimers). Biological Activity: The biological activity of TGF-beta 2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 less than 40ng/ml.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: Tris HCl 0.05M buffer at pH 7.4.
• Concentration: LYOPH
• Reconstitution Instructions: Reconstitute with water to a final concentration of 50 ng/ul.

Alternate Names for Recombinant TGF-beta 2 Protein

• BSC-1 cell growth inhibitor
• cetermin
• Glioblastoma-derived T-cell suppressor factor
• G-TSF
• MGC116892
• polyergin
• TGFB2
• TGFbeta 2
• TGF-beta 2
• TGF-beta2
• TGF-beta-2
• transforming growth factor beta-2
• transforming growth factor, beta 2

Background

Recombinant human TGF-beta 2 is a 27.08 kDa protein composed of two identical 118 amino acid peptide chains linked by a single disulfide bond. Transforming growth factor-beta is a family of five related cytokines that have been shown on a wide variety of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-beta (TGF-beta 1, TGF-beta 2 and TGF-beta 3) signal through the same receptor and elicit similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing. Source: It is produced by transient expression of TGF-beta 2 in non-transgenic plants. Recombinant human TGF-beta 2 contains a 6-His-tag at the N-terminal end and is purified by sequential chromatography (FPLC). This product contains no animal derived components or impurities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGFB2