TFPI Antibody

Images

 
Western Blot: TFPI Antibody [H00007035-D01P] - Analysis of TFPI expression in mouse liver.
Western Blot: TFPI Antibody [H00007035-D01P] - Analysis of TFPI expression in transfected 293T cell line by TFPI polyclonal antibody.Lane 1: TFPI transfected lysate(35.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFPI Antibody Summary

Immunogen
TFPI (NP_006278.1, 1 a.a. - 304 a.a.) full-length human protein. MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Specificity
Reacts with tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFPI
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TFPI Antibody

  • convertin
  • EPI
  • EPITFPI1LACITFI
  • Extrinsic pathway inhibitor
  • LACI
  • Lipoprotein-associated coagulation inhibitor
  • TFPI
  • tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
  • tissue factor pathway inhibitor

Background

This gene encodes a protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. The encoded protein is glycosylated and predominantly found in the vascular endothelium and plasma in both free forms and complexed with plasma lipoproteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been confirmed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2545
Species: Hu
Applications: WB, IHC, IP
H00007035-D01P
Species: Hu, Mu
Applications: WB

Publications for TFPI Antibody (H00007035-D01P) (0)

There are no publications for TFPI Antibody (H00007035-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFPI Antibody (H00007035-D01P) (0)

There are no reviews for TFPI Antibody (H00007035-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFPI Antibody (H00007035-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFPI Products

Bioinformatics Tool for TFPI Antibody (H00007035-D01P)

Discover related pathways, diseases and genes to TFPI Antibody (H00007035-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFPI Antibody (H00007035-D01P)

Discover more about diseases related to TFPI Antibody (H00007035-D01P).
 

Pathways for TFPI Antibody (H00007035-D01P)

View related products by pathway.

PTMs for TFPI Antibody (H00007035-D01P)

Learn more about PTMs related to TFPI Antibody (H00007035-D01P).

Blogs on TFPI

There are no specific blogs for TFPI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFPI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFPI
Entrez
Uniprot