TFIIE beta Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TFIIE beta Antibody [NBP1-87931] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TFIIE beta Antibody [NBP1-87931] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TFIIE beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TFIIE beta Antibody - BSA Free (NBP1-87931) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TFIIE beta Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTF2E2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 26996949). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TFIIE beta Protein (NBP1-87931PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TFIIE beta Antibody - BSA Free

• FE
• General transcription factor IIE subunit 2
• general transcription factor IIE, polypeptide 2 (beta subunit, 34kD)
• general transcription factor IIE, polypeptide 2, beta 34kDa
• TF2E2TFIIE-beta
• TFIIE-B
• transcription initiation factor IIE subunit beta

Background

Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase andDNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TFIIE beta Antibody (NBP1-87931)(1)

Publication using NBP1-87931

• Kuschal C, Botta E, Orioli D et al. GTF2E2 Mutations Destabilize the General Transcription Factor Complex TFIIE in Individuals with DNA Repair-Proficient Trichothiodystrophy. Am J Hum Genet 2016-04-07 [PMID: 26996949] (WB, Human)

Bioinformatics

• Gene Symbol: GTF2E2