TFIIE beta Antibody

Images

 
Western Blot: TFIIE beta Antibody [NBP1-87931] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: TFIIE beta Antibody [NBP1-87931] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: TFIIE beta Antibody [NBP1-87931] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Western Blot: TFIIE beta Antibody [NBP1-87931] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-577

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFIIE beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2E2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TFIIE beta Protein (NBP1-87931PEP)
Publications
Read Publication using
NBP1-87931 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TFIIE beta Antibody

  • FE
  • General transcription factor IIE subunit 2
  • general transcription factor IIE, polypeptide 2 (beta subunit, 34kD)
  • general transcription factor IIE, polypeptide 2, beta 34kDa
  • TF2E2TFIIE-beta
  • TFIIE-B
  • transcription initiation factor IIE subunit beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-35213
Species: Hu
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TFIIE beta Antibody (NBP1-87931)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TFIIE beta Antibody (NBP1-87931) (0)

There are no reviews for TFIIE beta Antibody (NBP1-87931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TFIIE beta Antibody (NBP1-87931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFIIE beta Products

Bioinformatics Tool for TFIIE beta Antibody (NBP1-87931)

Discover related pathways, diseases and genes to TFIIE beta Antibody (NBP1-87931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFIIE beta Antibody (NBP1-87931)

Discover more about diseases related to TFIIE beta Antibody (NBP1-87931).

Blogs on TFIIE beta

There are no specific blogs for TFIIE beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFIIE beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2E2