TFG Antibody - BSA Free

Western Blot: TFG Antibody [NBP2-56681] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunocytochemistry/Immunofluorescence: TFG Antibody [NBP2-56681] - Staining of human cell line U-251 MG shows localization to vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TFG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TFG Antibody - BSA Free (NBP2-56681) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TFG Recombinant Protein Antigen (NBP2-56681PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TFG Antibody - BSA Free

• FLJ36137
• protein TFG
• TF6
• TRK-fused gene protein
• TRK-fused gene
• TRKT3 oncogene
• TRKT3

Background

TRK-fused gene (TFG) has been identified as part of a chromosomal translocation [t(1,3)(q21;q11)] with NTRK1 in thyroid papillary carcinoma. TGF is implicated to play a role in modulating SHP-1 activity and has also been found to interact with TANK and NEMO, two proteins involved in the NF-kappaB signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFG