TFF1/pS2 Antibody (pS2.1)

Western Blot: TFF1/pS2 Antibody (pS2.1) [NB120-3079] - Analysis of Trefoil factor 1 using 30 ug of MCF-7 lysate. Samples were loaded onto a 15% SDS-PAGE gel and probed with a Trefoil factor 1 polyclonal antibody.

Immunohistochemistry-Paraffin: TFF1/pS2 Antibody (pS2.1) [NB120-3079] - Analysis of Trefoil factor 1 in paraffin-embedded gastric carcinoma using a Trefoil factor 1 polyclonal antibody.

Immunofluorescence: TFF1/pS2 Antibody (pS2.1) [NB120-3079] - Analysis of Trefoil factor 1 in methanol-fixed MCF-7 cells using a Trefoil factor 1 polyclonal antibody.

Product Discontinued

TFF1/pS2 Antibody (pS2.1) Summary

• Immunogen: A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein
• Epitope: Amino acids 54 - 84
• Localization: Cytoplasmic
• Specificity: pS2 (pS2.1)
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: TFF1
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10 - 1:500
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: May be useful in IHC-P.

Packaging, Storage & Formulations

• Storage: Store at 4C. Do not freeze.
• Buffer: PBS (pH 7.4) and 0.2% BSA
• Preservative: 0.09% Sodium Azide
• Concentration: 0.2 mg/ml
• Purity: Protein G purified

Alternate Names for TFF1/pS2 Antibody (pS2.1)

• BCEI
• BCEIbreast cancer, estrogen-inducible sequence expressed in
• Breast cancer estrogen-inducible protein
• breast cancer estrogen-inducible sequence
• D21S21
• gastrointestinal trefoil protein pS2
• hP1.A
• HPS2
• PNR-2
• Polypeptide P1.A
• Protein pS2
• PS2
• TFF1
• trefoil factor 1
• trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A

Background

pS2 is a cysteine-rich, 6.5 kDa protein found in both estrogen-dependent (breast tumors) and estrogen-independent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. pS2 is primarilyexpressed in estrogen receptor-positive breast tumors and is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFF1
• Entrez:
  • 7031(Human)