TdT Antibody - BSA Free

Western Blot: TdT Antibody [NBP1-58254] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TdT Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DNTT(deoxynucleotidyltransferase, terminal) The peptide sequence was selected from the N terminal of DNTT. Peptide sequence FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNTT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TdT Antibody - BSA Free

• deoxynucleotidyltransferase, terminal
• DNTT
• EC 2.7.7
• EC 2.7.7.31
• nucleosidetriphosphate:DNA deoxynucleotidylexotransferase
• TdT
• TDTDNA nucleotidylexotransferase
• Terminal addition enzyme
• Terminal deoxynucleotidyltransferase
• terminal deoxyribonucleotidyltransferase
• Terminal transferase

Background

DNTT is a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, DNTT is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TdT Antibody (NBP1-58254)(1)

Publication using NBP1-58254

• Troshchynsky A, Dzneladze I, Chen L et al. Functional analyses of polymorphic variants of human terminal deoxynucleotidyl transferase. Genes Immun 2015-06-04 [PMID: 26043173] (Human)

Bioinformatics

• Gene Symbol: DNTT
• Uniprot:
  • P04053(Human)