TCP11 Antibody - BSA Free

Immunohistochemistry-Paraffin: TCP11 Antibody [NBP2-14635] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TCP11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCP11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TCP11 Recombinant Protein Antigen (NBP2-14635PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TCP11 Antibody - BSA Free

• D6S230E
• KIAA0229
• MGC111103
• t-complex 11 (a murine tcp homolog)
• t-complex 11 homolog (mouse)
• T-complex protein 11 homolog

Background

TCP11 may play an important role in sperm function and fertility

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCP11