TCL1A Antibody (3G10)

Images

 
Western Blot: TCL1A Antibody (3G10) [H00008115-M07] - Analysis of TCL1A expression in transfected 293T cell line by TCL1A monoclonal antibody (M07), clone 3G10. Lane 1: TCL1A transfected lysatE (13.5 KDa). Lane 2: ...read more
ELISA: TCL1A Antibody (3G10) [H00008115-M07] - Detection limit for recombinant GST tagged TCL1A is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCL1A Antibody (3G10) Summary

Immunogen
TCL1A (NP_068801.1 61 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Specificity
TCL1A (3G10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCL1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCL1A Antibody (3G10)

  • Oncogene TCL1
  • Oncogene TCL-1
  • Protein p14 TCL1
  • T-cell leukemia/lymphoma 1A
  • T-cell lymphoma-1
  • T-cell lymphoma-1A
  • TCL1A
  • TCL1-PEN
  • TCL1T-cell leukemia/lymphoma protein 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58455
Species: Hu
Applications: ICC/IF
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP2-47608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBL1-16782
Species: Hu
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00008115-M07
Species: Hu
Applications: WB, ELISA

Publications for TCL1A Antibody (H00008115-M07) (0)

There are no publications for TCL1A Antibody (H00008115-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCL1A Antibody (H00008115-M07) (0)

There are no reviews for TCL1A Antibody (H00008115-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCL1A Antibody (H00008115-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCL1A Products

Bioinformatics Tool for TCL1A Antibody (H00008115-M07)

Discover related pathways, diseases and genes to TCL1A Antibody (H00008115-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCL1A Antibody (H00008115-M07)

Discover more about diseases related to TCL1A Antibody (H00008115-M07).
 

Pathways for TCL1A Antibody (H00008115-M07)

View related products by pathway.

PTMs for TCL1A Antibody (H00008115-M07)

Learn more about PTMs related to TCL1A Antibody (H00008115-M07).

Blogs on TCL1A

There are no specific blogs for TCL1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCL1A Antibody (3G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol TCL1A
Entrez
OMIM
Uniprot