Recombinant Human TCF7L2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human TCF7L2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 490-596 of Human TCF7L2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TCF7L2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TCF7L2 GST (N-Term) Protein

  • HMG box transcription factor 4
  • hTCF-4
  • T-cell factor 4
  • T-cell factor-4 variant A
  • T-cell factor-4 variant B
  • T-cell factor-4 variant C
  • T-cell factor-4 variant D
  • T-cell factor-4 variant E
  • T-cell factor-4 variant H
  • T-cell factor-4 variant I
  • T-cell factor-4 variant J
  • T-cell factor-4 variant K
  • T-cell factor-4 variant L
  • T-cell factor-4 variant M
  • T-cell factor-4 variant X2
  • T-cell-specific transcription factor 4
  • TCF-4T-cell factor-4 variant F
  • TCF4T-cell factor-4 variant G
  • transcription factor 7-like 2 (T-cell specific, HMG-box)
  • transcription factor 7-like 2

Background

T cell transcription factor 4 (TCF 4) is a transcription factor of the high Mobility Group of DNA binding proteins and is a member of the TCF-LEF family of transcription factors. It interacts with b-Catenin in the Wnt signaling pathway to activate transcription of Wnt target genes. T cell transcription factor 4 plays important roles in embryogenesis and oncogenesis. High levels of expression are found in developing CNS and limb buds. The brain is the major site of expression, however, T cell transcription factor 4 mRNA is also found in high levels in liver, lower in heart, lungs, kidneys, and testis, and lowest in spleen and muscle. In human T cell transcription factor 4, four alternative splice sites are observed which correspond to the synthesis of many T cell transcription factor 4 isoforms with short, medium, or long-C-terminal ends (ADDINENRfu). BLAST searches showed these isoforms are very similar to each other, except those that are close to the C-terminus, however, the calculated molecular weights ranged from 52kD to 68kD.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF6116
Species: Hu
Applications: ICC, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4885
Species: Mu
Applications: IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
MAB7650
Species: Mu
Applications: IHC, WB
MAB8224
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
MAB7936
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for TCF7L2 Partial Recombinant Protein (H00006934-Q01) (0)

There are no publications for TCF7L2 Partial Recombinant Protein (H00006934-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF7L2 Partial Recombinant Protein (H00006934-Q01) (0)

There are no reviews for TCF7L2 Partial Recombinant Protein (H00006934-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCF7L2 Partial Recombinant Protein (H00006934-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCF7L2 Products

Research Areas for TCF7L2 Partial Recombinant Protein (H00006934-Q01)

Find related products by research area.

Blogs on TCF7L2

There are no specific blogs for TCF7L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TCF7L2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF7L2