TCF-2/HNF-1 beta Antibody (4E9.)

Images

 
Western Blot: TCF-2/HNF-1 beta Antibody (4E9) [H00006928-M06] - Analysis of TCF2 expression in Raw 264.7 (Cat # L024V1).
Western Blot: TCF-2/HNF-1 beta Antibody (4E9) [H00006928-M06] - Analysis of TCF2 expression in HeLa (Cat # L013V1).
Western Blot: TCF-2/HNF-1 beta Antibody (4E9) [H00006928-M06] - Analysis of TCF2 expression in PC-12 (Cat # L012V1).
Western Blot: TCF-2/HNF-1 beta Antibody (4E9) [H00006928-M06] - Analysis of TCF2 expression in NIH/3T3 (Cat # L018V1).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
4E9.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCF-2/HNF-1 beta Antibody (4E9.) Summary

Immunogen
TCF2 (NP_000449, 29 a.a. - 118 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
Specificity
TCF2 - transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor (4E9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HNF1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF-2/HNF-1 beta Antibody (4E9.)

  • FJHN
  • hepatocyte nuclear factor 1-beta
  • HNF1 beta A
  • HNF-1 beta
  • HNF1 homeobox B
  • HNF1B
  • HNF-1B
  • HNF1beta
  • HNF-1-beta
  • HNF2
  • Homeoprotein LFB3
  • LFB3
  • LF-B3
  • MODY5
  • MODY5HPC11
  • TCF2
  • TCF-2
  • TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
  • Transcription factor 2
  • transcription factor 2, hepatic
  • Variant hepatic nuclear factor 1
  • VHNF1

Background

This gene encodes a member of the transcription factor superfamily. The encoded protein forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4186
Species: Hu
Applications: WB, ICC
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5596
Species: Hu
Applications: WB, IHC, ICC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
H00006928-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for TCF-2/HNF-1 beta Antibody (H00006928-M06) (0)

There are no publications for TCF-2/HNF-1 beta Antibody (H00006928-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF-2/HNF-1 beta Antibody (H00006928-M06) (0)

There are no reviews for TCF-2/HNF-1 beta Antibody (H00006928-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCF-2/HNF-1 beta Antibody (H00006928-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF-2/HNF-1 beta Products

Bioinformatics Tool for TCF-2/HNF-1 beta Antibody (H00006928-M06)

Discover related pathways, diseases and genes to TCF-2/HNF-1 beta Antibody (H00006928-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF-2/HNF-1 beta Antibody (H00006928-M06)

Discover more about diseases related to TCF-2/HNF-1 beta Antibody (H00006928-M06).
 

Pathways for TCF-2/HNF-1 beta Antibody (H00006928-M06)

View related products by pathway.

PTMs for TCF-2/HNF-1 beta Antibody (H00006928-M06)

Learn more about PTMs related to TCF-2/HNF-1 beta Antibody (H00006928-M06).
 

Research Areas for TCF-2/HNF-1 beta Antibody (H00006928-M06)

Find related products by research area.

Blogs on TCF-2/HNF-1 beta

There are no specific blogs for TCF-2/HNF-1 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF-2/HNF-1 beta Antibody (4E9.) and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF1B
Entrez
Uniprot