TCF-2/HNF-1 beta Antibody (4E9) - Azide and BSA Free

Western Blot: TCF-2/HNF-1 beta Antibody (4E9) [H00006928-M06] - Analysis of TCF2 expression in Raw 264.7 (Cat # L024V1).

Western Blot: TCF-2/HNF-1 beta Antibody (4E9) [H00006928-M06] - Analysis of TCF2 expression in HeLa (Cat # L013V1).

Western Blot: TCF-2/HNF-1 beta Antibody (4E9) [H00006928-M06] - Analysis of TCF2 expression in PC-12 (Cat # L012V1).

Western Blot: TCF-2/HNF-1 beta Antibody (4E9) [H00006928-M06] - Analysis of TCF2 expression in NIH/3T3 (Cat # L018V1).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 4E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TCF-2/HNF-1 beta Antibody (4E9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
• Specificity: TCF2 - transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor (4E9)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HNF1B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF-2/HNF-1 beta Antibody (4E9) - Azide and BSA Free

• FJHN
• hepatocyte nuclear factor 1-beta
• HNF1 beta A
• HNF-1 beta
• HNF1 homeobox B
• HNF1B
• HNF-1B
• HNF1beta
• HNF-1-beta
• HNF2
• Homeoprotein LFB3
• LFB3
• LF-B3
• MODY5
• MODY5HPC11
• TCF2
• TCF-2
• TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
• Transcription factor 2
• transcription factor 2, hepatic
• Variant hepatic nuclear factor 1
• VHNF1

Background

This gene encodes a member of the transcription factor superfamily. The encoded protein forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNF1B
• Entrez:
  • 6928(Human)
• Uniprot:
  • NP_000449(Human)