TCF-2/HNF-1 beta Antibody (3H4)

Western Blot: TCF-2/HNF-1 beta Antibody (3H4) [H00006928-M01] - TCF2 monoclonal antibody (M01), clone 3H4. Analysis of TCF2 expression in human lung cancer.

Immunocytochemistry/Immunofluorescence: TCF-2/HNF-1 beta Antibody (3H4) [H00006928-M01] - Analysis of monoclonal antibody to HNF1B on HeLa cell . Antibody concentration 10 ug/ml.

Western Blot: TCF-2/HNF-1 beta Antibody (3H4) [H00006928-M01] - TCF2 monoclonal antibody (M01), clone 3H4. Analysis of TCF2 expression in human skin.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3H4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

TCF-2/HNF-1 beta Antibody (3H4) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
• Specificity: TCF2 - transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor (3H4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HNF1B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF-2/HNF-1 beta Antibody (3H4)

• FJHN
• hepatocyte nuclear factor 1-beta
• HNF1 beta A
• HNF-1 beta
• HNF1 homeobox B
• HNF1B
• HNF-1B
• HNF1beta
• HNF-1-beta
• HNF2
• Homeoprotein LFB3
• LFB3
• LF-B3
• MODY5
• MODY5HPC11
• TCF2
• TCF-2
• TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
• Transcription factor 2
• transcription factor 2, hepatic
• Variant hepatic nuclear factor 1
• VHNF1

Background

This gene encodes a member of the transcription factor superfamily. The encoded protein forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNF1B
• Entrez:
  • 6928(Human)
• Uniprot:
  • NP_000449(Human)