TCF-2/HNF-1 beta Antibody (3H4)

Images

 
Western Blot: TCF-2/HNF-1 beta Antibody (3H4) [H00006928-M01] - TCF2 monoclonal antibody (M01), clone 3H4. Analysis of TCF2 expression in human lung cancer.
Immunocytochemistry/ Immunofluorescence: TCF-2/HNF-1 beta Antibody (3H4) [H00006928-M01] - Analysis of monoclonal antibody to HNF1B on HeLa cell . Antibody concentration 10 ug/ml.
Western Blot: TCF-2/HNF-1 beta Antibody (3H4) [H00006928-M01] - TCF2 monoclonal antibody (M01), clone 3H4. Analysis of TCF2 expression in human skin.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCF-2/HNF-1 beta Antibody (3H4) Summary

Immunogen
TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
Specificity
TCF2 - transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor (3H4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HNF1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF-2/HNF-1 beta Antibody (3H4)

  • FJHN
  • hepatocyte nuclear factor 1-beta
  • HNF1 beta A
  • HNF-1 beta
  • HNF1 homeobox B
  • HNF1B
  • HNF-1B
  • HNF1beta
  • HNF-1-beta
  • HNF2
  • Homeoprotein LFB3
  • LFB3
  • LF-B3
  • MODY5
  • MODY5HPC11
  • TCF2
  • TCF-2
  • TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
  • Transcription factor 2
  • transcription factor 2, hepatic
  • Variant hepatic nuclear factor 1
  • VHNF1

Background

This gene encodes a member of the transcription factor superfamily. The encoded protein forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4186
Species: Hu
Applications: ICC, WB
NBP2-27079
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF2419
Species: Hu
Applications: ICC, IHC, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB5175
Species: Mu
Applications: IHC, WB
NBP2-93878
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5596
Species: Hu
Applications: ICC, IHC, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
H00006928-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for TCF-2/HNF-1 beta Antibody (H00006928-M01) (0)

There are no publications for TCF-2/HNF-1 beta Antibody (H00006928-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF-2/HNF-1 beta Antibody (H00006928-M01) (0)

There are no reviews for TCF-2/HNF-1 beta Antibody (H00006928-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF-2/HNF-1 beta Antibody (H00006928-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF-2/HNF-1 beta Products

Bioinformatics Tool for TCF-2/HNF-1 beta Antibody (H00006928-M01)

Discover related pathways, diseases and genes to TCF-2/HNF-1 beta Antibody (H00006928-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF-2/HNF-1 beta Antibody (H00006928-M01)

Discover more about diseases related to TCF-2/HNF-1 beta Antibody (H00006928-M01).
 

Pathways for TCF-2/HNF-1 beta Antibody (H00006928-M01)

View related products by pathway.

PTMs for TCF-2/HNF-1 beta Antibody (H00006928-M01)

Learn more about PTMs related to TCF-2/HNF-1 beta Antibody (H00006928-M01).
 

Research Areas for TCF-2/HNF-1 beta Antibody (H00006928-M01)

Find related products by research area.

Blogs on TCF-2/HNF-1 beta

There are no specific blogs for TCF-2/HNF-1 beta, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF-2/HNF-1 beta Antibody (3H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF1B
Entrez
Uniprot