TCEB2 Antibody (7T5C1)

Western Blot: TCEB2 Antibody (7T5C1) [NBP3-33277] - Western blot analysis of various lysates using TCEB2 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 45s.

Western Blot: TCEB2 Antibody (7T5C1) [NBP3-33277] - Western blot analysis of various lysates using TCEB2 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 7T5C1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TCEB2 Antibody (7T5C1) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TCEB2 (NP_009039.1).
  
  Sequence:
  MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ELOB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 13 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TCEB2 Antibody (7T5C1)

• 18-kD subunit
• EloB
• Elongin 18 kDa subunit
• elongin-B
• RNA polymerase II transcription factor SIII p18 subunit
• RNA polymerase II transcription factor SIII subunit B
• SIII p18
• transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
• transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
• transcription elongation factor B polypeptide 2

Background

TCEB2 encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELOB