TCEB1 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human TCEB1 (NP_001191791.1). MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ELOC |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TCEB1 Antibody - BSA Free
Background
Elongin C (also known as RNA polymerase II transcription factor SIII p15 subunit and transcription elongation factor B polypeptide 1) is a 15 kD member of the SKP1 family. Elongin functions as a regulatory subunit of a general transcription elongation factor that increases RNA polymerase II transcription elongation past template-encoded arresting sites in the nucleus. The Elongin BC complex acts as adaptor to link Elongin A, VHL, WSB1 or SOCS1 with a module of CUL2 or CUL5 and RBX1 to form E3 ubiquitin ligases. The Poly6131 antibody recognizes the human and mouse elongin C protein and has been shown to be useful for Western blotting.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for TCEB1 Antibody (NBP2-94131) (0)
There are no publications for TCEB1 Antibody (NBP2-94131).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TCEB1 Antibody (NBP2-94131) (0)
There are no reviews for TCEB1 Antibody (NBP2-94131).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TCEB1 Antibody (NBP2-94131) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TCEB1 Products
Research Areas for TCEB1 Antibody (NBP2-94131)
Find related products by research area.
|
Blogs on TCEB1