TCEB2 Antibody (6F6)

Images

 
Western Blot: TCEB2 Antibody (6F6) [H00006923-M01] - TCEB2 monoclonal antibody (M01), clone 6F6. Analysis of TCEB2 expression in PC-12.
Immunocytochemistry/ Immunofluorescence: TCEB2 Antibody (6F6) [H00006923-M01] - Analysis of monoclonal antibody to TCEB2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: TCEB2 Antibody (6F6) [H00006923-M01] - TCEB2 monoclonal antibody (M01), clone 6F6 Analysis of TCEB2 expression in Hela S3 NE.
Sandwich ELISA: TCEB2 Antibody (6F6) [H00006923-M01] - Detection limit for recombinant GST tagged TCEB2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCEB2 Antibody (6F6) Summary

Immunogen
TCEB2 (NP_009039, 9 a.a. - 118 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Localization
Nuclear
Specificity
TCEB2 - transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCEB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCEB2 Antibody (6F6)

  • 18-kD subunit
  • EloB
  • Elongin 18 kDa subunit
  • elongin-B
  • RNA polymerase II transcription factor SIII p18 subunit
  • RNA polymerase II transcription factor SIII subunit B
  • SIII p18
  • transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
  • transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
  • transcription elongation factor B polypeptide 2

Background

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-44091
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-87040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBL1-16214
Species: Hu
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TCEB2 Antibody (H00006923-M01) (0)

There are no publications for TCEB2 Antibody (H00006923-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEB2 Antibody (H00006923-M01) (0)

There are no reviews for TCEB2 Antibody (H00006923-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCEB2 Antibody (H00006923-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCEB2 Products

Bioinformatics Tool for TCEB2 Antibody (H00006923-M01)

Discover related pathways, diseases and genes to TCEB2 Antibody (H00006923-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCEB2 Antibody (H00006923-M01)

Discover more about diseases related to TCEB2 Antibody (H00006923-M01).
 

Pathways for TCEB2 Antibody (H00006923-M01)

View related products by pathway.

PTMs for TCEB2 Antibody (H00006923-M01)

Learn more about PTMs related to TCEB2 Antibody (H00006923-M01).

Blogs on TCEB2

There are no specific blogs for TCEB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCEB2 Antibody (6F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEB2
Entrez
OMIM
Uniprot