TCEB1 Antibody

Images

 
Western Blot: TCEB1 Antibody [NBP2-83629] - WB Suggested Anti-TCEB1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Raji cell lysateTCEB1 is strongly supported by BioGPS gene expression data to be expressed in Human ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCEB1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TCEB1. Peptide sequence: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ELOC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCEB1 Antibody

  • eloC
  • Elongin 15 kDa subunit
  • elongin-C
  • RNA polymerase II transcription factor SIII subunit C
  • SIII p15
  • SIII
  • transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C)
  • transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
  • transcription elongation factor B polypeptide 1
  • transcription elongation factor B, polypeptide 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87581
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-45210
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-87040
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00612
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBL1-16214
Species: Hu
Applications: WB
H00006923-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB

Publications for TCEB1 Antibody (NBP2-83629) (0)

There are no publications for TCEB1 Antibody (NBP2-83629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEB1 Antibody (NBP2-83629) (0)

There are no reviews for TCEB1 Antibody (NBP2-83629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCEB1 Antibody (NBP2-83629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCEB1 Products

Bioinformatics Tool for TCEB1 Antibody (NBP2-83629)

Discover related pathways, diseases and genes to TCEB1 Antibody (NBP2-83629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCEB1 Antibody (NBP2-83629)

Discover more about diseases related to TCEB1 Antibody (NBP2-83629).
 

Pathways for TCEB1 Antibody (NBP2-83629)

View related products by pathway.

PTMs for TCEB1 Antibody (NBP2-83629)

Learn more about PTMs related to TCEB1 Antibody (NBP2-83629).
 

Research Areas for TCEB1 Antibody (NBP2-83629)

Find related products by research area.

Blogs on TCEB1

There are no specific blogs for TCEB1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCEB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELOC