TBX6 Antibody (2D11)

Images

 
Immunocytochemistry/ Immunofluorescence: TBX6 Antibody (2D11) [H00006911-M01] - Analysis of monoclonal antibody to TBX6 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: TBX6 Antibody (2D11) [H00006911-M01] - Detection limit for recombinant GST tagged TBX6 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
2D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TBX6 Antibody (2D11) Summary

Immunogen
TBX6 (NP_004599 191 a.a. - 299 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE
Specificity
TBX6 (2D11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TBX6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TBX6 Antibody (2D11)

  • DFNB67
  • T-box 6
  • T-box protein 6
  • T-box transcription factor TBX6
  • TBX6

Background

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx6. Knockout experiments in mice indicate that Tbx6 is important for specification of paraxial mesoderm structures. Transcript variants encoding different isoforms have been noted for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu
Applications: WB, IHC
423-F8/CF
Species: Hu, Mu
AF2085
Species: Hu, Mu
Applications: WB, IHC, ChIP, ICC
NBP2-37424
Species: Hu
Applications: WB, ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49036
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80699
Species: Hu
Applications: IHC, IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89459
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TBX6 Antibody (H00006911-M01) (0)

There are no publications for TBX6 Antibody (H00006911-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX6 Antibody (H00006911-M01) (0)

There are no reviews for TBX6 Antibody (H00006911-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBX6 Antibody (H00006911-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBX6 Products

Bioinformatics Tool for TBX6 Antibody (H00006911-M01)

Discover related pathways, diseases and genes to TBX6 Antibody (H00006911-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX6 Antibody (H00006911-M01)

Discover more about diseases related to TBX6 Antibody (H00006911-M01).
 

Pathways for TBX6 Antibody (H00006911-M01)

View related products by pathway.

PTMs for TBX6 Antibody (H00006911-M01)

Learn more about PTMs related to TBX6 Antibody (H00006911-M01).

Blogs on TBX6

There are no specific blogs for TBX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX6 Antibody (2D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX6
Entrez
OMIM
Uniprot