TBX10 Antibody

Images

 
Western Blot: TBX10 Antibody [NBP1-68982] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Brain.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBX10 Antibody Summary

Immunogen
Synthetic peptides corresponding to Tbx10 (T-box 10) The peptide sequence was selected from the N terminal of Tbx10. Peptide sequence YAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBX10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Tbx10 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TBX10 Antibody

  • T-box 10
  • T-box 7
  • T-box protein 10
  • T-box transcription factor TBX10
  • T-box-containing transcriptional activator
  • TBX13
  • TBX7

Background

Tbx10 is a probable transcriptional regulator involved in developmental processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu
Applications: WB, IHC
NBP1-89481
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
27550002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83619
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
H00010253-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-68982
Species: Mu
Applications: WB

Publications for TBX10 Antibody (NBP1-68982) (0)

There are no publications for TBX10 Antibody (NBP1-68982).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX10 Antibody (NBP1-68982) (0)

There are no reviews for TBX10 Antibody (NBP1-68982). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBX10 Antibody (NBP1-68982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBX10 Products

Bioinformatics Tool for TBX10 Antibody (NBP1-68982)

Discover related pathways, diseases and genes to TBX10 Antibody (NBP1-68982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX10 Antibody (NBP1-68982)

Discover more about diseases related to TBX10 Antibody (NBP1-68982).
 

Pathways for TBX10 Antibody (NBP1-68982)

View related products by pathway.

Blogs on TBX10

There are no specific blogs for TBX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX10
Uniprot