TBX1 Recombinant Protein Antigen

Images

 
There are currently no images for TBX1 Recombinant Protein Antigen (NBP2-56667PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TBX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBX1.

Source: E. coli

Amino Acid Sequence: TFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TBX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56667.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TBX1 Recombinant Protein Antigen

  • brachyury
  • CAFS
  • CTHM
  • DGCR
  • DGS
  • DORV
  • T-box 1 transcription factor C
  • T-box 1
  • T-box protein 1
  • T-box transcription factor TBX1
  • TBX1C
  • Testis-specific T-box protein
  • TGA
  • VCFS

Background

The T-box (TBX) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The TBX gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. TBX genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in TBX genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of TBX products has come mainly from the prototypical T/Brachyury, which is a transcription activator. The TBX genes constitute a family of transcriptional regulatory genes that are implicated in a variety of developmental processes ranging from the formation of germ layers to the organizational patterning of the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

314-BP
Species: Hu
Applications: BA, BA
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
AF2444
Species: Hu
Applications: IHC, WB
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00006910-M01
Species: Fi, Hu, Pm, Mu
Applications: ELISA, ICC/IF, KD, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
7734-LF
Species: Hu
Applications: BA
3218-ND
Species: Hu
Applications: BA
345-FG
Species: Hu
Applications: BA
H00006909-M01
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
AF4086
Species: Hu
Applications: ICC, WB
233-FB
Species: Hu
Applications: BA
NBP2-56667PEP
Species: Hu
Applications: AC

Publications for TBX1 Recombinant Protein Antigen (NBP2-56667PEP) (0)

There are no publications for TBX1 Recombinant Protein Antigen (NBP2-56667PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX1 Recombinant Protein Antigen (NBP2-56667PEP) (0)

There are no reviews for TBX1 Recombinant Protein Antigen (NBP2-56667PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TBX1 Recombinant Protein Antigen (NBP2-56667PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBX1 Products

Blogs on TBX1

There are no specific blogs for TBX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TBX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX1