TBX1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TBX1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBX1.

  Source: E. coli

  Amino Acid Sequence: TFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TBX1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56667.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TBX1 Recombinant Protein Antigen

• brachyury
• CAFS
• CTHM
• DGCR
• DGS
• DORV
• T-box 1 transcription factor C
• T-box 1
• T-box protein 1
• T-box transcription factor TBX1
• TBX1C
• Testis-specific T-box protein
• TGA
• VCFS

Background

The T-box (TBX) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The TBX gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. TBX genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in TBX genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of TBX products has come mainly from the prototypical T/Brachyury, which is a transcription activator. The TBX genes constitute a family of transcriptional regulatory genes that are implicated in a variety of developmental processes ranging from the formation of germ layers to the organizational patterning of the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TBX1