TBX1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TBX1 Antibody [NBP2-56667] - Staining of human cell line HEK 293 shows localization to nuclear bodies & cytoplasmic bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBX1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKD
Specificity
Specificity of human TBX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBX1 Recombinant Protein Antigen (NBP2-56667PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TBX1 Antibody

  • brachyury
  • CAFS
  • CTHM
  • DGCR
  • DGS
  • DORV
  • T-box 1 transcription factor C
  • T-box 1
  • T-box protein 1
  • T-box transcription factor TBX1
  • TBX1C
  • Testis-specific T-box protein
  • TGA
  • VCFS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP2-27406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006909-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for TBX1 Antibody (NBP2-56667) (0)

There are no publications for TBX1 Antibody (NBP2-56667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX1 Antibody (NBP2-56667) (0)

There are no reviews for TBX1 Antibody (NBP2-56667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBX1 Antibody (NBP2-56667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBX1 Products

Bioinformatics Tool for TBX1 Antibody (NBP2-56667)

Discover related pathways, diseases and genes to TBX1 Antibody (NBP2-56667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX1 Antibody (NBP2-56667)

Discover more about diseases related to TBX1 Antibody (NBP2-56667).
 

Pathways for TBX1 Antibody (NBP2-56667)

View related products by pathway.

PTMs for TBX1 Antibody (NBP2-56667)

Learn more about PTMs related to TBX1 Antibody (NBP2-56667).

Blogs on TBX1

There are no specific blogs for TBX1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX1