We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TBX1 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: TBX1 Antibody [NBP2-56667] - Staining of human cell line HEK 293 shows localization to nuclear bodies & cytoplasmic bodies. Antibody staining is shown in green.

Product Details

Summary
Product Discontinued
View other related TBX1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-56667
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TBX1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKD
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TBX1 Antibody - BSA Free

  • brachyury
  • CAFS
  • CTHM
  • DGCR
  • DGS
  • DORV
  • T-box 1 transcription factor C
  • T-box 1
  • T-box protein 1
  • T-box transcription factor TBX1
  • TBX1C
  • Testis-specific T-box protein
  • TGA
  • VCFS

Background

The T-box (TBX) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The TBX gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. TBX genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in TBX genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of TBX products has come mainly from the prototypical T/Brachyury, which is a transcription activator. The TBX genes constitute a family of transcriptional regulatory genes that are implicated in a variety of developmental processes ranging from the formation of germ layers to the organizational patterning of the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

314-BP
Applications: BA, BA
AF1759
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Applications: ChIP, ICC, IHC, Simple Western, WB
H00006910-M01
Species: Fi, Hu, Pm, Mu
Applications: ELISA, ICC/IF, KD, WB
7734-LF
Applications: BA
H00006909-M01
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-56667
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for TBX1 Antibody (NBP2-56667) (0)

There are no publications for TBX1 Antibody (NBP2-56667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX1 Antibody (NBP2-56667) (0)

There are no reviews for TBX1 Antibody (NBP2-56667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBX1 Antibody (NBP2-56667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX1