TBCA Antibody (1D2)

Images

 
Western Blot: TBCA Antibody (1D2) [H00006902-M03] - Analysis of TBCA expression in transfected 293T cell line by TBCA monoclonal antibody (M03), clone 1D2. Lane 1: TBCA transfected lysatE (12.9 KDa). Lane 2: ...read more
Sandwich ELISA: TBCA Antibody (1D2) [H00006902-M03] - Detection limit for recombinant GST tagged TBCA is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TBCA Antibody (1D2) Summary

Immunogen
TBCA (AAH18210, 1 a.a. - 108 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMSAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Specificity
TBCA - tubulin-specific chaperone a (1D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TBCA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TBCA Antibody (1D2)

  • CFA
  • chaperonin cofactor A
  • TCP1-chaperonin cofactor A
  • tubulin folding cofactor A
  • Tubulin-folding cofactor A
  • tubulin-specific chaperone a

Background

The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. This gene encodes chaperonin cofactor A. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for TBCA Antibody (H00006902-M03) (0)

There are no publications for TBCA Antibody (H00006902-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBCA Antibody (H00006902-M03) (0)

There are no reviews for TBCA Antibody (H00006902-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBCA Antibody (H00006902-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBCA Products

Bioinformatics Tool for TBCA Antibody (H00006902-M03)

Discover related pathways, diseases and genes to TBCA Antibody (H00006902-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBCA Antibody (H00006902-M03)

Discover more about diseases related to TBCA Antibody (H00006902-M03).
 

Pathways for TBCA Antibody (H00006902-M03)

View related products by pathway.

PTMs for TBCA Antibody (H00006902-M03)

Learn more about PTMs related to TBCA Antibody (H00006902-M03).

Blogs on TBCA

There are no specific blogs for TBCA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBCA Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol TBCA
Entrez
Uniprot