TBC1D24 Antibody


Immunohistochemistry-Paraffin: TBC1D24 Antibody [NBP1-82925] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

TBC1D24 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RGKVYQRLIRDIPCRTVTPDASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLCLANQFPD
Specificity of human TBC1D24 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TBC1D24 Protein (NBP1-82925PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TBC1D24 Antibody

  • KIAA1171FIME
  • MGC102885
  • TBC1 domain family member 24
  • TBC1 domain family, member 24


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu
Species: Hu
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TBC1D24 Antibody (NBP1-82925) (0)

There are no publications for TBC1D24 Antibody (NBP1-82925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D24 Antibody (NBP1-82925) (0)

There are no reviews for TBC1D24 Antibody (NBP1-82925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TBC1D24 Antibody (NBP1-82925). (Showing 1 - 1 of 1 FAQ).

  1. Does this react against rat TBC1D24?
    • We have not yet tested this in rat however the immunogen has 93% homology so it is very likely to detect the rat protein. If you would be interested in testing this novel species, please take a look at our Innovators Reward Program.

Secondary Antibodies


Isotype Controls

Additional TBC1D24 Products

Bioinformatics Tool for TBC1D24 Antibody (NBP1-82925)

Discover related pathways, diseases and genes to TBC1D24 Antibody (NBP1-82925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D24 Antibody (NBP1-82925)

Discover more about diseases related to TBC1D24 Antibody (NBP1-82925).

Pathways for TBC1D24 Antibody (NBP1-82925)

View related products by pathway.

Blogs on TBC1D24

There are no specific blogs for TBC1D24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TBC1D24 Antibody and receive a gift card or discount.


Gene Symbol TBC1D24