TBC1D24 Antibody - BSA Free

Immunohistochemistry-Paraffin: TBC1D24 Antibody [NBP1-82925] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBC1D24 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBC1D24 Antibody - BSA Free (NBP1-82925) is a polyclonal antibody validated for use in IHC and WB. Anti-TBC1D24 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGKVYQRLIRDIPCRTVTPDASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLCLANQFPD
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBC1D24
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 30602030
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TBC1D24 Protein (NBP1-82925PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30602030).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBC1D24 Antibody - BSA Free

• KIAA1171FIME
• MGC102885
• TBC1 domain family member 24
• TBC1 domain family, member 24

Background

TBC1D24 may act as a GTPase-activating protein for Rab family protein(s)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TBC1D24 Antibody (NBP1-82925)(4)

Publications using NBP1-82925

• Pepe S, Aprile D, Castroflorio E, Marte A et Al. TBC1D24 interacts with the v-ATPase and regulates intraorganellar pH in neurons iScience 2025-01-06 [PMID: 39758816]
• Defourny J. TBC1D24 is likely to regulate vesicle trafficking in glia-like non-sensory epithelial cells of the cochlea. The International journal of developmental biology 2024-07-17 [PMID: 38869222]
• Tona R, Lopez IA, Fenollar-Ferrer C et al. Mouse Models of Human Pathogenic Variants of TBC1D24 Associated with Non-Syndromic Deafness DFNB86 and DFNA65 and Syndromes Involving Deafness Genes (Basel) 2020-09-24 [PMID: 32987832] (Immunohistochemistry, Western Blot, Mouse)
• Tona R, Chen W, Nakano Y et al. The phenotypic landscape of a Tbc1d24 mutant mouse includes convulsive seizures resembling human early infantile epileptic encephalopathy. Hum. Mol. Genet. 2019-01-02 [PMID: 30602030] (IF/IHC, WB, Mouse)

FAQs for TBC1D24 Antibody (NBP1-82925). (Showing 1 - 1 of 1 FAQs).

1. Does this react against rat TBC1D24?
   • We have not yet tested this in rat however the immunogen has 93% homology so it is very likely to detect the rat protein. If you would be interested in testing this novel species, please take a look at our Innovators Reward Program.

Bioinformatics

• Gene Symbol: TBC1D24