TBC1D10A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TBC1D10A Antibody [NBP2-55894] - Staining of human cell line SK-MEL-30 shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D10A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL',)
Specificity
Specificity of human TBC1D10A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D10A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TBC1D10A Antibody

  • EBP50-PDX interactor of 64 kDa
  • EPI64
  • rab27A-GAP-alpha
  • TBC1 domain family member 10A
  • TBC1 domain family, member 10A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54654
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP2-67165
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-67820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-83870
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76350
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-84918
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005873-M02
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP2-62651
Species: Hu
Applications: WB, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
NB110-81529
Species: Hu, Mu, Rt, Po, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IP, IF
NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82756
Species: Hu
Applications: IHC, IHC-P
NBP2-49616
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20042
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92455
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57094
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86053
Species: Hu
Applications: IHC, IHC-P
NBP2-55894
Species: Hu
Applications: ICC/IF

Publications for TBC1D10A Antibody (NBP2-55894) (0)

There are no publications for TBC1D10A Antibody (NBP2-55894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D10A Antibody (NBP2-55894) (0)

There are no reviews for TBC1D10A Antibody (NBP2-55894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBC1D10A Antibody (NBP2-55894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBC1D10A Products

Bioinformatics Tool for TBC1D10A Antibody (NBP2-55894)

Discover related pathways, diseases and genes to TBC1D10A Antibody (NBP2-55894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D10A Antibody (NBP2-55894)

Discover more about diseases related to TBC1D10A Antibody (NBP2-55894).
 

Pathways for TBC1D10A Antibody (NBP2-55894)

View related products by pathway.

PTMs for TBC1D10A Antibody (NBP2-55894)

Learn more about PTMs related to TBC1D10A Antibody (NBP2-55894).

Blogs on TBC1D10A

There are no specific blogs for TBC1D10A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D10A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D10A