Tapasin Antibody

Western Blot: Tapasin Antibody [NBP1-59071] - Antibody Titration: 1 ug/ml Human liver.

Immunocytochemistry/Immunofluorescence: Tapasin Antibody [NBP1-59071] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.

Immunohistochemistry-Paraffin: Tapasin Antibody [NBP1-59071] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.

Western Blot: Tapasin Antibody [NBP1-59071] - analysis of HepG2 tissue lysate at a concentration of 0.5ug/ml.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Tapasin Antibody Summary

• Immunogen: Synthetic peptides corresponding to TAPBP(TAP binding protein (tapasin)) The peptide sequence was selected from the C terminal of TAPBP. Peptide sequence GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAPBP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1 : 600
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
• Application Notes: This is a rabbit polyclonal antibody against TAPBP and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Tapasin Antibody

• NGS17
• NGS-17
• TAP binding protein (tapasin)
• TAP Binding Protein
• TAPA
• Tapasin
• TAPATAP-associated protein
• TAPBP
• TPN
• TPSN
• TPSNTAP-binding protein

Background

TAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAPBP
• Uniprot:
  • O15533(Human)