Talin2 Antibody (7D1Y0)

Western Blot: Talin2 Antibody (7D1Y0) [NBP3-15932] - Western blot analysis of extracts of various cell lines, using Talin2 Rabbit mAb (NBP3-15932) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Talin2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Talin2 Antibody (7D1Y0) [Talin2] - Confocal imaging of paraffin-embedded Mouse brain tissue using Talin2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Talin2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Talin2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Talin2 Antibody (7D1Y0) [Talin2] - Confocal imaging of paraffin-embedded Rat brain tissue using Talin2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Talin2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 7D1Y0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Talin2 Antibody (7D1Y0) Summary

• Description: Novus Biologicals Rabbit Talin2 Antibody (7D1Y0) (NBP3-15932) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Talin2 (Q9Y4G6). VLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRTGKAEHGSV
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TLN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
  • Immunohistochemistry 1:500 - 1:2000
  • Immunohistochemistry-Paraffin 1:500 - 1:2000
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 272 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Talin2 Antibody (7D1Y0)

• DKFZp451B1011
• DKFZp686I0976
• DKFZp686K0979
• ILWEQ
• KIAA0320
• Talin2
• talin-2
• TLN 2
• TLN2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TLN2