FXR1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FXR1 Antibody [NBP1-89546] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.

Simple Western: FXR1 Antibody [NBP1-89546] - Simple Western lane view shows a specific band for FXR1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: FXR1 Antibody [NBP1-89546] - Electropherogram image(s) of corresponding Simple Western lane view. FXR1 antibody was used at 1:100 dilution on RT-4 and U-251MG sp lysates(s).

Analysis in human cell line U-251 MG.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FXR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FXR1 Antibody - BSA Free (NBP1-89546) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-FXR1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FXR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:100
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:100, apparent MW was 68 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  FXR1 Protein (NBP1-89546PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FXR1 Antibody - BSA Free

• fragile X mental retardation syndrome-related protein 1
• fragile X mental retardation, autosomal homolog 1
• FXR1P
• hFXR1p

Background

FXR1 is encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FXR1 Antibody (NBP1-89546)(1)

Publication using NBP1-89546

• Fischer-Keso R, Breuninger S, Hofmann S et al. Plakophilins 1 and 3 Bind to FXR1 and Thereby Influence the mRNA Stability of Desmosomal Proteins. Mol Cell Biol 2014-12-01 [PMID: 25225333] (WB, Human)

Bioinformatics

• Gene Symbol: FXR1