Tafazzin/TAZ Recombinant Protein Antigen

Images

 
There are currently no images for Tafazzin/TAZ Recombinant Protein Antigen (NBP1-88511PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tafazzin/TAZ Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WWTR1.

Source: E. coli

Amino Acid Sequence: WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAFAZZIN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88511.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tafazzin/TAZ Recombinant Protein Antigen

  • BTHSEFE
  • cardiomyopathy, dilated 3A (X-linked)
  • CMD3A
  • EFE2FLJ27390
  • G4.5endocardial fibroelastosis 2
  • LVNCX
  • Protein G4.5
  • tafazzin
  • Taz1
  • XAP-2

Background

Tafazzin / TAZ encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternative transcripts encoding additional isoforms have been described but the full-length nature of these transcripts is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP1-81763
Species: Hu
Applications: IHC,  IHC-P
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, PLA, Simple Western, WB
H00011155-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, KD, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF3767
Species: Hu, Mu, Rt
Applications: IHC, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NB100-74451
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB

Publications for Tafazzin/TAZ Recombinant Protein Antigen (NBP1-88511PEP) (0)

There are no publications for Tafazzin/TAZ Recombinant Protein Antigen (NBP1-88511PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tafazzin/TAZ Recombinant Protein Antigen (NBP1-88511PEP) (0)

There are no reviews for Tafazzin/TAZ Recombinant Protein Antigen (NBP1-88511PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tafazzin/TAZ Recombinant Protein Antigen (NBP1-88511PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tafazzin/TAZ Products

Research Areas for Tafazzin/TAZ Recombinant Protein Antigen (NBP1-88511PEP)

Find related products by research area.

Blogs on Tafazzin/TAZ

There are no specific blogs for Tafazzin/TAZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tafazzin/TAZ Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAFAZZIN