Tafazzin/TAZ Antibody (1B10)

Images

 
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in human kidney.
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in PC-12 (Cat # L012V1).
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in SW-13 (Cat # L005V1).
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in human uterus myoma.
ELISA: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Detection limit for recombinant GST tagged TAZ is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
1B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Tafazzin/TAZ Antibody (1B10) Summary

Immunogen
TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
Specificity
TAZ (1B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAZ
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for ELISA.
Reviewed Applications
Read 1 Review rated 3
using
H00006901-M12 in the following applications:

Publications
Read Publications using
H00006901-M12 in the following applications:

  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28515468).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tafazzin/TAZ Antibody (1B10)

  • BTHSEFE
  • cardiomyopathy, dilated 3A (X-linked)
  • CMD3A
  • EFE2FLJ27390
  • G4.5endocardial fibroelastosis 2
  • LVNCX
  • Protein G4.5
  • tafazzin
  • Taz1
  • XAP-2

Background

This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternative transcripts encoding additional isoforms have been described but the full-length nature of these transcripts is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NBP1-81763
Species: Hu
Applications: WB, IHC, IHC-P
NB110-58359
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP, PLA
H00011155-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, RNAi, S-ELISA
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-56506
Species: Hu, Mu, Rt, Ma, Ma
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB110-68281
Species: Hu, Mu, Rt, Pm
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-22527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MAB5285
Species: Hu
Applications: WB, Simple Western
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for Tafazzin/TAZ Antibody (H00006901-M12)(5)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 5 of 5.
Publications using H00006901-M12 Applications Species
Val Fajardo, John Mikhaeil, Cameron Leveille et al. Cardiolipin content, linoleic acid composition, and tafazzin expression in response to skeletal muscle overload and unload stimuli. Sci Rep. [PMID: 28515468] (WB, Mouse) WB Mouse
Li J, Fang L, Yu W, Wang Y. MicroRNA-125b suppresses the migration and invasion of hepatocellular carcinoma cells by targeting transcriptional coactivator with PDZ-binding motif Oncology Letters. 2015 Feb 29 [PMID: 25789078] (WB, Human)

Details:
Tafazzin/TAZ antibody was used at 1:1500 dilution with 2 hour incubation at 37C for WB application on lysates of SK-Hep-1 cells transfected with si-TAZ or TAZ plasmid lacking 3'UTR along with miR-125b (Figure 4A), and on cells overexpressing TAZ and/or miR-125b (Figure 4B). WB was also performed on SK-Hep-1 cells overexpressing miR-125b and Huh7 cells treated or not with miR-125b inhibitor (Figure 3).
WB Human
Raghunathan VK, Dreier B, Morgan JT et al. Involvement of YAP, TAZ and HSP90 in Contact Guidance and Intercellular Junction Formation in Corneal Epithelial Cells. PLoS One. 2014 Oct 07 [PMID: 25290150]
Thomasy SM, Morgan JT, Wood JA et al. Substratum stiffness and latrunculin B modulate the gene expression of the mechanotransducers YAP and TAZ in human trabecular meshwork cells. Exp Eye Res. 2013 May 29 [PMID: 23727052]
Raghunathan VK, Morgan JT, Dreier B et al. Role of substratum stiffness in modulating genes associated with extracellular matrix and mechanotransducers YAP and TAZ. Invest Ophthalmol Vis Sci. 2013 Jan 14 [PMID: 23258147]

Review for Tafazzin/TAZ Antibody (H00006901-M12) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00006901-M12:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Tafazzin/TAZ H00006901-M12
Enlarge
3
reviewed by:
Anonymous
WB Mouse 08/26/2016
View

Summary

ApplicationWestern Blot
Sample TestedSoleus
SpeciesMouse

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tafazzin/TAZ Antibody (H00006901-M12) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Tafazzin/TAZ Products

Bioinformatics Tool for Tafazzin/TAZ Antibody (H00006901-M12)

Discover related pathways, diseases and genes to Tafazzin/TAZ Antibody (H00006901-M12). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tafazzin/TAZ Antibody (H00006901-M12)

Discover more about diseases related to Tafazzin/TAZ Antibody (H00006901-M12).
 

Pathways for Tafazzin/TAZ Antibody (H00006901-M12)

View related products by pathway.

PTMs for Tafazzin/TAZ Antibody (H00006901-M12)

Learn more about PTMs related to Tafazzin/TAZ Antibody (H00006901-M12).
 

Research Areas for Tafazzin/TAZ Antibody (H00006901-M12)

Find related products by research area.

Blogs on Tafazzin/TAZ

There are no specific blogs for Tafazzin/TAZ, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
08/26/2016
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol TAZ
Entrez
OMIM
Uniprot