TACI/TNFRSF13B/CVID Antibody

Images

 
Immunohistochemistry-Paraffin: TACI/TNFRSF13B/CVID Antibody [NBP1-84596] - Staining of human lymph node shows cytoplasmic positivity in germinal center cells and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TACI/TNFRSF13B/CVID Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFRSF13B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TACI/TNFRSF13B/CVID Recombinant Protein Antigen (NBP1-84596PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TACI/TNFRSF13B/CVID Antibody

  • CD267 antigen
  • CD267
  • CVID
  • CVID2
  • FLJ39942
  • MGC133214
  • TACI
  • TACIMGC39952
  • TNFRSF13B
  • TNFRSF14B
  • Transmembrane activator and CAML interactor
  • tumor necrosis factor receptor 13B
  • tumor necrosis factor receptor superfamily member 13B
  • tumor necrosis factor receptor superfamily, member 13B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-97637
Species: Hu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC
AF1162
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
NBP2-01801
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TACI/TNFRSF13B/CVID Antibody (NBP1-84596) (0)

There are no publications for TACI/TNFRSF13B/CVID Antibody (NBP1-84596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TACI/TNFRSF13B/CVID Antibody (NBP1-84596) (0)

There are no reviews for TACI/TNFRSF13B/CVID Antibody (NBP1-84596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TACI/TNFRSF13B/CVID Antibody (NBP1-84596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TACI/TNFRSF13B/CVID Products

Bioinformatics Tool for TACI/TNFRSF13B/CVID Antibody (NBP1-84596)

Discover related pathways, diseases and genes to TACI/TNFRSF13B/CVID Antibody (NBP1-84596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TACI/TNFRSF13B/CVID Antibody (NBP1-84596)

Discover more about diseases related to TACI/TNFRSF13B/CVID Antibody (NBP1-84596).
 

Pathways for TACI/TNFRSF13B/CVID Antibody (NBP1-84596)

View related products by pathway.

PTMs for TACI/TNFRSF13B/CVID Antibody (NBP1-84596)

Learn more about PTMs related to TACI/TNFRSF13B/CVID Antibody (NBP1-84596).

Blogs on TACI/TNFRSF13B/CVID

There are no specific blogs for TACI/TNFRSF13B/CVID, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TACI/TNFRSF13B/CVID Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF13B
Entrez