T-bet/TBX21 Antibody (1D12)

Images

 
Western Blot: T-bet/TBX21 Antibody (1D12) [H00030009-M09] - Analysis of TBX21 expression in transfected 293T cell line by TBX21 monoclonal antibody (M09), clone 1D12. Lane 1: TBX21 transfected lysatE (58.3 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

T-bet/TBX21 Antibody (1D12) Summary

Immunogen
TBX21 (AAH39739.1, 387 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPE
Specificity
TBX21 - T-box 21 (1D12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TBX21
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for T-bet/TBX21 Antibody (1D12)

  • Tbet
  • T-bet
  • TBETT-PET
  • TBLYM
  • TBLYMT-cell-specific T-box transcription factor T-bet
  • T-box 21
  • T-box expressed in T cells
  • T-box protein 21
  • T-box transcription factor TBX21
  • TBX21
  • T-PET
  • Transcription factor TBLYM

Background

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
Applications: BA
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
202-IL
Species: Hu
Applications: BA
DY421
Species: Mu
Applications: ELISA
M5000
Species: Mu
Applications: ELISA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
M1300CB
Species: Mu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NBP2-67868
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB6166
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
MAB15041
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
7268-CT
Species: Hu
Applications: BA
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB

Publications for T-bet/TBX21 Antibody (H00030009-M09) (0)

There are no publications for T-bet/TBX21 Antibody (H00030009-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for T-bet/TBX21 Antibody (H00030009-M09) (0)

There are no reviews for T-bet/TBX21 Antibody (H00030009-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for T-bet/TBX21 Antibody (H00030009-M09). (Showing 1 - 1 of 1 FAQ).

  1. Do you make a Tbx21 ab for FACS for porcine?
    • We have not tested our Tbx21 antibodies for porcine, however you might like to test NBP1-43298 as part of our Innovators Reward Program. This is gained from testing a product on a species or application that we have not yet tested. I have carried out a blast to check the % homology between the pig protein and human protein, this is 94% and our lab recommends use if the % homology is 85% or above.

Secondary Antibodies

 

Isotype Controls

Additional T-bet/TBX21 Products

Bioinformatics Tool for T-bet/TBX21 Antibody (H00030009-M09)

Discover related pathways, diseases and genes to T-bet/TBX21 Antibody (H00030009-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for T-bet/TBX21 Antibody (H00030009-M09)

Discover more about diseases related to T-bet/TBX21 Antibody (H00030009-M09).
 

Pathways for T-bet/TBX21 Antibody (H00030009-M09)

View related products by pathway.

PTMs for T-bet/TBX21 Antibody (H00030009-M09)

Learn more about PTMs related to T-bet/TBX21 Antibody (H00030009-M09).
 

Research Areas for T-bet/TBX21 Antibody (H00030009-M09)

Find related products by research area.

Blogs on T-bet/TBX21

There are no specific blogs for T-bet/TBX21, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our T-bet/TBX21 Antibody (1D12) and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX21
Entrez
Uniprot