SYT11 Antibody (4E1) - Azide and BSA Free

Western Blot: SYT11 Antibody (4e1) [H00023208-M03] - Analysis of SYT11 expression in IMR-32 (Cat # L008V1).

Immunocytochemistry/Immunofluorescence: SYT11 Antibody (4e1) [H00023208-M03] - Analysis of monoclonal antibody to SYT11 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: SYT11 Antibody (4e1) [H00023208-M03] - Detection limit for recombinant GST tagged SYT11 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4E1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SYT11 Antibody (4E1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SYT11 Antibody (4E1) - Azide and BSA Free (H00023208-M03) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SYT11 (NP_689493, 84 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL
• Specificity: SYT11 (4e1)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SYT11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SYT11 Antibody (4E1) - Azide and BSA Free

• DKFZp781D015
• KIAA0080synaptotagmin 12
• MGC10881
• MGC17226
• synaptotagmin XISYT12
• synaptotagmin-11
• sytXI

Background

SYT11 may be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYT11
• Entrez:
  • 23208(Human)
• OMIM:
  • 608741(Human)
• Uniprot:
  • NP_689493(Human)