Syntrophin beta 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Syntrophin beta 1 Antibody [NBP1-90323] - Staining of human soft tissue shows cytoplasmic positivity in peripheral neurons.
Immunohistochemistry: Syntrophin beta 1 Antibody [NBP1-90323] - Staining of human kidney shows weak cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntrophin beta 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QGCHNSAELIAEISTACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSDDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNTB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Syntrophin beta 1 Protein (NBP1-90323PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syntrophin beta 1 Antibody

  • beta-1-syntrophin
  • 59-DAP
  • A1B
  • BSYN2
  • DAPA1B
  • SNT2
  • SNT2B1
  • syntrophin, beta 1 (dystrophin-associated protein A1, 59kDa, basic component 1)
  • TIP-43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
AF8537
Species: Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-83420
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA

Publications for Syntrophin beta 1 Antibody (NBP1-90323) (0)

There are no publications for Syntrophin beta 1 Antibody (NBP1-90323).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntrophin beta 1 Antibody (NBP1-90323) (0)

There are no reviews for Syntrophin beta 1 Antibody (NBP1-90323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Syntrophin beta 1 Antibody (NBP1-90323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntrophin beta 1 Products

Bioinformatics Tool for Syntrophin beta 1 Antibody (NBP1-90323)

Discover related pathways, diseases and genes to Syntrophin beta 1 Antibody (NBP1-90323). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntrophin beta 1 Antibody (NBP1-90323)

Discover more about diseases related to Syntrophin beta 1 Antibody (NBP1-90323).
 

Pathways for Syntrophin beta 1 Antibody (NBP1-90323)

View related products by pathway.

Blogs on Syntrophin beta 1

There are no specific blogs for Syntrophin beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntrophin beta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNTB1