Syntaxin 7 Antibody - BSA Free

Western Blot: Syntaxin 7 Antibody [NBP3-09402] - Western blot analysis of Syntaxin 7 in 721_B Whole Cell. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Syntaxin 7 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Syntaxin 7 (NP_003560). Peptide sequence PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STX7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Syntaxin 7 Antibody - BSA Free

• STX7
• Syntaxin 7
• syntaxin-7

Background

Syntaxin 7 is involved in the ordered fusion of endosomes and lysosomes with the phagosome, where phagocytic cells kill and degrade internalized foreign particles. Syntaxin 7 is found in late endosomes and lysosomes; whereas Syntaxin 12 is localized to the recycling endosome compartment, both are recruited to the phagosome. However, STX12 is acquired earlier before rapidly recycling off the phagosome, whereas STX7 is recruited later and continues to accumulate throughout the phagosome maturation process.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STX7