Syntaxin 7 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Syntaxin 7 Antibody - BSA Free (NBP3-09402) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human Syntaxin 7 (NP_003560). Peptide sequence PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
STX7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Syntaxin 7 Antibody - BSA Free
Background
Syntaxin 7 is involved in the ordered fusion of endosomes and lysosomes with the phagosome, where phagocytic cells kill and degrade internalized foreign particles. Syntaxin 7 is found in late endosomes and lysosomes; whereas Syntaxin 12 is localized to the recycling endosome compartment, both are recruited to the phagosome. However, STX12 is acquired earlier before rapidly recycling off the phagosome, whereas STX7 is recruited later and continues to accumulate throughout the phagosome maturation process.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Syntaxin 7 Antibody (NBP3-09402) (0)
There are no publications for Syntaxin 7 Antibody (NBP3-09402).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Syntaxin 7 Antibody (NBP3-09402) (0)
There are no reviews for Syntaxin 7 Antibody (NBP3-09402).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Syntaxin 7 Antibody (NBP3-09402) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Syntaxin 7 Products
Research Areas for Syntaxin 7 Antibody (NBP3-09402)
Find related products by research area.
|
Blogs on Syntaxin 7