SYNE1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SYNE1 Antibody [NBP1-89349] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry-Paraffin: SYNE1 Antibody [NBP1-89349] - Staining of human skeletal muscle shows strong cytoplasmic and nuclear membranous positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SYNE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SYNE1 Protein (NBP1-89349PEP)
Publications
Read Publication using NBP1-89349.

Reactivity Notes

Mouse (86%), Rat (82%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYNE1 Antibody

  • ARCA1
  • C6orf98
  • CPG2
  • dJ45H2.2
  • EC 4.2.1.49
  • EC 4.3.1.3
  • EDMD4
  • enaptin
  • KIAA0796chromosome 6 open reading frame 98
  • KIAA1262FLJ41140
  • KIAA17568B
  • Myne-1
  • MYNE1DKFZp781J13156
  • Myocyte nuclear envelope protein 1
  • nesprin 1
  • nesprin-1
  • Nuclear envelope spectrin repeat protein 1
  • SCAR8FLJ30878
  • spectrin repeat containing, nuclear envelope 1
  • Synaptic nuclear envelope protein 1
  • synaptic nuclei expressed gene 1
  • Syne-1
  • SYNE-1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59944
Species: Hu
Applications: WB, ICC/IF
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-49175
Species: Hu
Applications: WB, IHC
46770002
Species: Hu
Applications: ELISA
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SYNE1 Antibody (NBP1-89349)(1)

Reviews for SYNE1 Antibody (NBP1-89349) (0)

There are no reviews for SYNE1 Antibody (NBP1-89349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SYNE1 Antibody (NBP1-89349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYNE1 Products

Bioinformatics Tool for SYNE1 Antibody (NBP1-89349)

Discover related pathways, diseases and genes to SYNE1 Antibody (NBP1-89349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYNE1 Antibody (NBP1-89349)

Discover more about diseases related to SYNE1 Antibody (NBP1-89349).
 

Pathways for SYNE1 Antibody (NBP1-89349)

View related products by pathway.

PTMs for SYNE1 Antibody (NBP1-89349)

Learn more about PTMs related to SYNE1 Antibody (NBP1-89349).

Blogs on SYNE1

There are no specific blogs for SYNE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYNE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNE1