Synaptotagmin 12 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Synaptotagmin 12 Antibody - BSA Free (NBP2-88392) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human Synaptotagmin 12. Peptide sequence: LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SYT12 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Synaptotagmin 12 Antibody - BSA Free
Background
May be involved in ca(2+)-dependent exocytosis of secretory vesicles through ca(2+) and phospholipid binding to the c2 domain or may serve as ca(2+) sensors in the process of vesicular trafficking and exocytosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu
Applications: WB
Species: Ca, Fe, Hu, Mu, Sh
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Publications for Synaptotagmin 12 Antibody (NBP2-88392) (0)
There are no publications for Synaptotagmin 12 Antibody (NBP2-88392).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Synaptotagmin 12 Antibody (NBP2-88392) (0)
There are no reviews for Synaptotagmin 12 Antibody (NBP2-88392).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Synaptotagmin 12 Antibody (NBP2-88392) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Synaptotagmin 12 Products
Research Areas for Synaptotagmin 12 Antibody (NBP2-88392)
Find related products by research area.
|
Blogs on Synaptotagmin 12