Synaptotagmin 1 Antibody


Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Lanes: Lane1: 10ug mouse cortex brain lysate. Lane2: 25ug mouse cortex brain lysate. Lane3: 40ug mouse cortex brain lysate. Primary Antibody Dilution: 1:1000. more
Immunocytochemistry/ Immunofluorescence: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary Dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 more
Immunohistochemistry: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: complete mouse retina sections. Red: Primary. Blue: DAPI. Primary Dilution: 1:200. Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L). more
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Synaptotagmin 1 in bovine oocytes. Image from confirmed customer review.
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity Mu, BvSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Synaptotagmin 1 Antibody Summary

Synthetic peptide directed towards the middle region of human Syt1. Peptide sequence FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
WB reported via verified customer review.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
NBP1-91499 in the following applications:

Reactivity Notes

Bovine data from customer review.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Synaptotagmin 1 Antibody

  • DKFZp781D2042
  • P65
  • SVP65
  • synaptotagmin Isynaptotagmin 1
  • Synaptotagmin1
  • Synaptotagmin-1
  • SYT
  • SYT1
  • SytI


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu
Applications: Neut, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-P, In vitro, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for Synaptotagmin 1 Antibody (NBP1-91499) (0)

There are no publications for Synaptotagmin 1 Antibody (NBP1-91499).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Synaptotagmin 1 Antibody (NBP1-91499) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-91499:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Synaptotagmin 1 NBP1-91499
reviewed by:
Allison Tscherner
WB Other 02/20/2014


ApplicationWestern Blot
Sample TestedOocytes


Blocking Details60min 5% milk in TBST at room temp

Primary Anitbody

Dilution Ratio1:1000 at 4 degrees C overnight

Secondary Antibody

Secondary DescriptionAnti-rabbit IgG, HRP
Secondary Manufacturer Cat#CST#7074
Secondary Concentration1:2000


Detection NotesECL

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Synaptotagmin 1 Antibody (NBP1-91499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Synaptotagmin 1 Products

Bioinformatics Tool for Synaptotagmin 1 Antibody (NBP1-91499)

Discover related pathways, diseases and genes to Synaptotagmin 1 Antibody (NBP1-91499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 1 Antibody (NBP1-91499)

Discover more about diseases related to Synaptotagmin 1 Antibody (NBP1-91499).

Pathways for Synaptotagmin 1 Antibody (NBP1-91499)

View related products by pathway.

PTMs for Synaptotagmin 1 Antibody (NBP1-91499)

Learn more about PTMs related to Synaptotagmin 1 Antibody (NBP1-91499).

Blogs on Synaptotagmin 1

There are no specific blogs for Synaptotagmin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Allison Tscherner
Application: WB
Species: Other


Gene Symbol SYT1