Home » Synaptotagmin 1 » Synaptotagmin-1 Antibodies » Synaptotagmin 1 Antibody

Synaptotagmin 1 Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Lanes: Lane1: 10ug mouse cortex brain lysate. Lane2: 25ug mouse cortex brain lysate. Lane3: 40ug mouse cortex brain lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Anti-rabbit HRP. Secondary Antibody Dilution: 1:2000. Gene Name: Syt1. Submi
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Lanes: Lane1: 10ug mouse cortex brain lysate. Lane2: 25ug mouse cortex brain lysate. Lane3: 40ug mouse cortex brain lysate. Primary Antibody Dilution: 1:1000. ...read more
Immunocytochemistry/ Immunofluorescence: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary Dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 ...read more
Immunohistochemistry: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: complete mouse retina sections. Red: Primary. Blue: DAPI. Primary Dilution: 1:200. Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L). ...read more
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Synaptotagmin 1 in bovine oocytes. Image from confirmed customer review.
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity Mu, Bv, Hu, Rt, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Synaptotagmin 1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human Syt1. Peptide sequence FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Zebrafish (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
Application Notes
WB reported via verified customer review.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-91499 in the following applications:

Reactivity Notes

Bovine data from customer review.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Synaptotagmin 1 Antibody

  • DKFZp781D2042
  • P65
  • SVP65
  • synaptotagmin Isynaptotagmin 1
  • Synaptotagmin1
  • Synaptotagmin-1
  • SYT
  • SYT1
  • sytI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(3 Publications)
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(31 Reviews)
(645 Publications)
Species: Hu
CD40/TNFRSF5
Antibody (mAb89)
DDX0131P-100
Immunocytochemistry/Immunofluorescence: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - CD40-transfected L cells stained.
Immunohistochemistry: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - IHC staining on Bouin paraffinlymph node section. HumanCD40 stained with mAb 89.
(11 Publications)
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Species: Hu
Applications: WB, IHC, IHC-P, KD
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Western Blot: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ASCC1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ASCC1.
Immunocytochemistry/Immunofluorescence: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] Staining of COS7 cells transiently transfected by pCMV6-ENTRY ASCC1.
Immunohistochemistry-Paraffin: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - Staining of paraffin-embedded Human tonsil using anti-ASCC1 mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Immunofluorescence indicates NF-kB p65 subunit was expressed exclusively in AA-G groups and AST-G cytoplasm. High glucose stimulation impact on TSMCs in NF-kB pathway. (A) NF-kB p65 protein subunit expression in TSMCs in each group. (B) NF-kB p65 subunit immunofluorescence. Each number denotes different subunits. Alexa 488 green served as secondary antibodies.Citation: Hara K, Hamada C, Wakabayashi K, Kanda R, Kaneko K, Horikoshi S, et al. (2017) Scavenging of reactive oxygen species by astaxanthin inhibits epithelial-mesenchymal transition in high glucose-stimulated mesothelial cells. PLoS ONE 12(9): e0184332. https://doi.org/10.1371/journal.pone.0184332
(85 Publications)
Species: Hu, Mu, Rt
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
IkB-alpha Antibody
(6A920)
NB100-56507
Knockout Validated: IkB-alpha Antibody (6A920) [NB100-56507] - Western blot shows lysates of HEK293 human embryonic kidney parental cell line and IkB-alpha knockout (KO) HEK293 human embryonic kidney cell line. PVDF membrane was probed with 2 ug/ml of Mouse Anti-Human IkB-alpha monoclonal Antibody (Catalog # NB100-56507) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody. Specific band was detected for IkB-alpha at approximately 38 kDa (as indicated) in the parental HEK293 celll line, but is not detectable in the knockout HEK293 cell line. This experiment was conducted under reducing conditions.
Western Blot: IkB-alpha Antibody (6A920) [NB100-56507] - Lysates of Jurkat human acute T cell leukemia cell line, LNCaP human prostate cancer cell line, PCx2011;3 human prostate cancer cell line, HeLa human cervical epithelial carcinoma cell line, and NIHx2011;3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 0.5 ug/mL mouse anti-IkB-a monoclonal (NB100-56507, Novus Biologicals), followed by 1:2000 dilution of the appropriate HRP-conjugated secondary antibody, donkey anti-mouse IgG.
Immunocytochemistry/Immunofluorescence: IkB-alpha Antibody (6A920) [NB100-56507] - Hek293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-IkB-alpha (6A920) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(35 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
iNOS Antibody
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Lung tissue.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Heart tissue.
(3 Reviews)
(53 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
c-Rel Antibody
[Unconjugated]
AF2699
Western blot shows lysates of Raji human Burkitt's lymphoma cell line, A20 mouse B cell lymphoma cell line, and CH‑1 mouse B cell lymphoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse c-Rel Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2699) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Rel at approximately 69 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL and 200 ng/mL PMA and calcium ionomycin for overnight was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. c‑Rel/DNA complexes were immuno­precipitated using 5 μg Goat Anti-Human/Mouse c‑Rel Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2699) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The p21 promoter was detected by standard PCR.
Simple Western lane view shows lysates of CH‑1 mouse B cell lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Rel at approximately 71 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse c‑Rel Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2699) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).
Simple Western: COX-2 Antibody [NB100-689] - Simple Western lane view shows a specific band for COX2 in 1.0 mg/ml of Rat Brain at an antibody concentration of 1:100. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Image provided through customer review.
(1 Review)
(26 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
ISYNA1 Antibody
NBP2-47415
Western Blot: ISYNA1 Antibody [NBP2-47415] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HEK 293
Immunocytochemistry/Immunofluorescence: ISYNA1 Antibody [NBP2-47415] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human placenta.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Neurofascin
Antibody
AF3235
Western blot shows lysates of rat brain tissue, mouse brain tissue, and human brain (cerebellum). PVDF Membrane was probed with 0.1 µg/mL of Chicken Anti-Human/Mouse/Rat Neurofascin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3235) followed by HRP-conjugated Anti-Chicken IgY Secondary Antibody. Specific bands were detected for Neurofascin at approximately 140 and186 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Neurofascin was detected in perfusion fixed frozen sections of rat brain (dorsal root ganglion) using Chicken Anti-Human/Mouse/Rat Neurofascin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3235) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Chicken IgY Secondary Antibody (yellow; Catalog # NL016) and counterstained with DAPI (blue). Specific staining was localized to neuronal cell bodies and Schwann cells (perinodal regions). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
IL-8/CXCL8 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(8 Reviews)
(93 Publications)
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC

Publications for Synaptotagmin 1 Antibody (NBP1-91499) (0)

There are no publications for Synaptotagmin 1 Antibody (NBP1-91499).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Synaptotagmin 1 Antibody (NBP1-91499) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-91499:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Synaptotagmin 1 NBP1-91499
Enlarge 		5
reviewed by:
Allison Tscherner
 WB Other 02/20/2014
View

Summary

ApplicationWestern Blot
Sample TestedOocytes
SpeciesOther
LotQC30410

Blocking

Blocking Details60min 5% milk in TBST at room temp

Primary Anitbody

Dilution Ratio1:1000 at 4 degrees C overnight

Secondary Antibody

Secondary DescriptionAnti-rabbit IgG, HRP
Secondary Manufacturer Cat#CST#7074
Secondary Concentration1:2000

Details

Detection NotesECL

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Synaptotagmin 1 Antibody (NBP1-91499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Synaptotagmin 1 Products

Bioinformatics Tool for Synaptotagmin 1 Antibody (NBP1-91499)

Discover related pathways, diseases and genes to Synaptotagmin 1 Antibody (NBP1-91499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 1 Antibody (NBP1-91499)

Discover more about diseases related to Synaptotagmin 1 Antibody (NBP1-91499).
 

Pathways for Synaptotagmin 1 Antibody (NBP1-91499)

View related products by pathway.

PTMs for Synaptotagmin 1 Antibody (NBP1-91499)

Learn more about PTMs related to Synaptotagmin 1 Antibody (NBP1-91499).

Blogs on Synaptotagmin 1

There are no specific blogs for Synaptotagmin 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Western Blot Synaptotagmin 1 NBP1-91499
Enlarge
 Allison Tscherner
02/20/2014
Application: WB
Species: Other
read this review

Bioinformatics

Gene Symbol SYT1
Uniprot