Synaptotagmin 1 Antibody

Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Lanes: Lane1: 10ug mouse cortex brain lysate. Lane2: 25ug mouse cortex brain lysate. Lane3: 40ug mouse cortex brain lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Anti-rabbit HRP. Secondary Antibody Dilution: 1:2000. Gene Name: Syt1. Submi

Immunohistochemistry: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary Dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary Dilution: 1:200, Image Submitted by: David Zenisek, Yale University.

Immunohistochemistry: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: complete mouse retina sections. Red: Primary. Blue: DAPI. Primary Dilution: 1:200. Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L). Secondary Dilution: 1:200. Image Submitted by: David Zenisek. Yale University

Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Synaptotagmin 1 in bovine oocytes. Image from confirmed customer review.

Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Mu, Bv
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

Synaptotagmin 1 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human Syt1. Peptide sequence FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Application Notes: WB reported via verified customer review.
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Bovine data from customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Synaptotagmin 1 Antibody

• DKFZp781D2042
• P65
• SVP65
• synaptotagmin Isynaptotagmin 1
• Synaptotagmin1
• Synaptotagmin-1
• SYT
• SYT1
• sytI

Background

Synaptotagmin is widely regarded as the primary calcium sensor for synaptic vesicle exocytosis (Fernandez-Chacon et al., 2001; Wang et al., 2003). Moreover recent studies indicate that the protein also plays a key role in endocytosis (Poskanzer et al., 2003). Synaptotagmin can be phosphorylated by multiple protein kinases and this may play a key role in modulation of synaptotagmin ability to influence both the exocytotic and endocytotic components of synaptic transmission (Hilfiker et al., 1999; Lee et al., 2004).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for Synaptotagmin 1 Antibody (NBP1-91499) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: Verified Customer WB Other 02/20/2014

Summary

• Application: Western Blot
• Sample Tested: Oocytes
• Species: Other
• Lot: QC30410

Bioinformatics

• Gene Symbol: SYT1
• Uniprot:
  • NP_033332(Mouse)