Synaptogyrin 3 Antibody - BSA Free

Western Blot: Synaptogyrin 3 Antibody [NBP2-88391] - Host: Rabbit. Target Name: SYNGR3. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Synaptogyrin 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Synaptogyrin 3 Antibody - BSA Free (NBP2-88391) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human Synaptogyrin 3. Peptide sequence: MSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYNGR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Synaptogyrin 3 Antibody - BSA Free

• MGC20003
• synaptogyrin 3
• synaptogyrin-3

Background

The Synaptogyrin 3 gene encodes an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYNGR3