Synapsin II Antibody (7J6L0)

Western Blot: Synapsin II Antibody (7J6L0) [NBP3-15765] - Western blot analysis of extracts of 293T cells, using Synapsin II Rabbit mAb (NBP3-15765) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: Synapsin II Antibody (7J6L0) [Synapsin II] - Confocal imaging of paraffin-embedded Mouse brain using Synapsin II Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: Synapsin II Antibody (7J6L0) [Synapsin II] - Confocal imaging of paraffin-embedded Rat brain using Synapsin II Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 7J6L0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Synapsin II Antibody (7J6L0) Summary

• Description: Novus Biologicals Rabbit Synapsin II Antibody (7J6L0) (NBP3-15765) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human Synapsin II (Q92777). HLIIGMQYAGLPSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQT
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SYN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Synapsin II Antibody (7J6L0)

• synapsin IISYNII
• synapsin-2
• SYNIIa
• SYNIIb

Background

Synapsin II is a member of the synapsin gene family. Synapsins are neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family is a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYN2