SUV420H2 Antibody - Azide and BSA Free

Western Blot: SUV420H2 Antibody [NBP2-94300] - Western blot analysis of extracts of various cell lines, using SUV420H2 antibody (NBP2-94300) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: SUV420H2 Antibody [NBP2-94300] - Western blot analysis of extracts from normal (control) and SUV420H2 Rabbit pAb knockout (KO) 293T cells, using SUV420H2 Rabbit pAb antibody (NBP2-94300) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: SUV420H2 Antibody [NBP2-94300] - Western blot analysis of extracts of Mouse thymus, using SUV420H2 antibody (NBP2-94300) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SUV420H2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit SUV420H2 Antibody - Azide and BSA Free (NBP2-94300) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2). FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KMT5C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Knockout Validated
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SUV420H2 Antibody - Azide and BSA Free

• EC 2.1.1.43
• FLJ98627
• histone-lysine N-methyltransferase SUV420H2
• KMT5C
• KMT5Csuv4-20h2
• Lysine N-methyltransferase 5C
• MGC2705
• PP7130
• Su(var)4-20 homolog 2
• suppressor of variegation 4-20 homolog 2 (Drosophila)
• Suppressor of variegation 4-20 homolog 2
• SUV420H2
• Suv4-20h2

Background

SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specificallytrimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) (Schotta et al., 2004 (PubMed15145825)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KMT5C