Home » H4/h » H4/h Antibodies » H4/h Antibody (6D4)

H4/h Antibody (6D4)

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: H4/h Antibody (6D4) [H00008365-M01] - Analysis of monoclonal antibody to HIST1H4H on HeLa cell . Antibody concentration 10 ug/ml.
Immunocytochemistry/ Immunofluorescence: H4/h Antibody (6D4) [H00008365-M01] - Analysis of monoclonal antibody to HIST1H4H on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: H4/h Antibody (6D4) [H00008365-M01] - Detection limit for recombinant GST tagged HIST1H4H is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF, S-ELISA
Clone
6D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

H4/h Antibody (6D4) Summary

Immunogen
HIST1H4H (NP_003534, 31 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Specificity
HIST1H4H - histone 1, H4h
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HIST1H4H
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H4/h Antibody (6D4)

  • H4 histone family, member H
  • H4/A
  • H4/B
  • H4/C
  • H4/D
  • H4/E
  • H4/h
  • H4/I
  • H4/J
  • H4/K
  • H4/M
  • H4/N
  • H4/O
  • H4F2
  • H4FA
  • H4FB
  • H4FC
  • H4FD
  • H4FE
  • H4FG
  • H4FHH4/G
  • H4FI
  • H4FJ
  • H4FK
  • H4FM
  • H4FN
  • H4FO
  • HIST1H4A
  • HIST1H4B
  • HIST1H4C
  • HIST1H4D
  • HIST1H4E
  • HIST1H4F
  • HIST1H4I
  • HIST1H4J
  • HIST1H4K
  • HIST1H4L
  • HIST2H4
  • HIST2H4A
  • HIST2H4B
  • HIST4H4
  • histone 1, H4h
  • histone cluster 1, H4h
  • histone H4

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(24 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HDAC9 Antibody -
BSA Free
NBP2-03993
Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Review)
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
HDAC1 Antibody
NB100-56340
Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Simple Western: HDAC1 Antibody [NB100-56340] - Simple Western lane view shows a specific band for HDAC1 in 0.5 mg/ml of HEK293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.
(2 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
H2A Antibody (4C10)
H00008337-M01
Immunocytochemistry/Immunofluorescence: H2A Antibody (4C10) [H00008337-M01] - Analysis of monoclonal antibody to HIST2H2AA3 on HeLa cell . Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, WB
Histone H2a
Antibody
NB100-56346
Western Blot: Histone H2a Antibody [NB100-56346] - Analysis of Histone H2A in human PBMC lysate probed with Histone H2A antibody.
Western Blot: Histone H2a Antibody [NB100-56346] - Histone H2A in MCF-7 and HCT-116 cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Histone H2a Antibody [NB100-56346] - Human breast probed with Histone H2A antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(1 Review)
(3 Publications)
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Flow Cytometry: KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on Raw264.7 cells with KAT3B/p300 Antibody (RW105) NB100-616 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B/p300 Antibody (RW105) NB100-616 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(9 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
SETD8 Antibody -
BSA Free
NBP1-91269
Western Blot: SETD8 Antibody [NBP1-91269] - Western blot analysis of SETD8 in Lane 1. SETD8 overexpression vector containing C-terminal DDK tag. Lane 2. Empty vector.
Western Blot: SETD8 Antibody [NBP1-91269] - Analysis of SETD8 in whole cell lysates of mouse proliferating neural progenitors (P) and differentiating neural stem cell (D) using anti-SETD8 antibody. Image from verified customer review.
(2 Reviews)
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
ELISA: Peroxiredoxin 2 Antibody (4E1.0-2D2) [H00007001-M01] - Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.
Knockdown Validated: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 knockdown increases PRDX4 protein levels in HeLa cells. HeLa subclones were exposed to 20% or 1% O2 for indicated time. Each WCL was subject to immunoblot assays with the indicated antibodies (PRDX2 H00007001-M01 and PRDX4 NBP1-31435). Image collected and cropped by CiteAb from the following publication (oncotarget.com/abstract/7142), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Airway
Trypsin-like Protease ...
2695-SE
Airway Trypsin-like Protease/HAT/TMPRSS11D
(3 Publications)
Species: Hu
Applications: EnzAct
Sir2.1 Antibody
NB100-1923
Western Blot: Sir2.1 Antibody [NB100-1923] - Western blot using NB100-1923 against His tagged SIR-2.1 full-length protein.
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ChIP, IP, WB
Histone
Deacetylase 2/HDAC2 A
NBP1-87109
Immunocytochemistry/Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Western Blot: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HDAC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody [NBP1-87109] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
HDAC3 Antibody
NB100-1669
Immunocytochemistry/Immunofluorescence: HDAC3 Antibody [NB100-1669] - HDAC3 preferably binds to nuclear Htt with long Qs. HDAC3 associates exclusively with nuclear inclusion bodies. E3 or N3 cells were fixed and stained with anti-HDAC3 antibodies and visualized by Alexa 546 conjugated secondary antibodies. Arrowheads: inclusion bodies with no HDAC3 signals associated. Arrows: HDAC3 signal-associated inclusion bodies. Bar?=?20 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0111277), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: HDAC3 Antibody [NB100-1669] - HDAC3 antibody was tested in HeLa cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue). An antibody dilution of 1:10 was used. Image objective 40x.
Simple Western: HDAC3 Antibody [NB100-1669] - Lane view shows a specific band for HDAC3 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(9 Publications)
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
MYST1 Antibody
NB100-55251
Immunohistochemistry-Paraffin: MYST1 Antibody [NB100-55251] - FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit antiMOF/MYST1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: MYST1 Antibody [NB100-55251] - Detection of human MOF/MYST1 by western blot and immunoprecipitation. Samples: Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and HEK293T (T; 50 ug) cells. Antibodies: Affinity purified rabbit anti-MOF/MYST1 antibody NB100-55251 (lot NB100-55251-2) used for WB at 0.4 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate (B). MOF/MYST1 was also immunoprecipitated by a previous lot (lot NB100-55251-1) of this antibody. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
Western Blot: MYST1 Antibody [NB100-55251] - Whole cell lysate (50 ug) from NIH3T3 cells. Antibodies: Affinity purified rabbit anti-MOF/MYST1 antibody used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
TIP60 Antibody
NBP2-24613
Immunohistochemistry-Paraffin: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Western Blot: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in human brain lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain and 4) rat brain lysate using this antibody. 25 ug/ml.
Simple Western: TIP60 Antibody [NBP2-24613] - Simple Western lane view shows a specific band for TIP60 in 0.2 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Carcinoma of Human thyroid tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: IHC, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA: D4S234E Antibody (1C3) [H00027065-M01] - Detection limit for recombinant GST tagged D4S234E is approximately 0.1ng/ml as a capture antibody.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.
Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody
Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
H4/h Antibody (6D4)
H00008365-M01
H4/h Antibody (6D4)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA

Publications for H4/h Antibody (H00008365-M01) (0)

There are no publications for H4/h Antibody (H00008365-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H4/h Antibody (H00008365-M01) (0)

There are no reviews for H4/h Antibody (H00008365-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for H4/h Antibody (H00008365-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional H4/h Products

Array H00008365-M01

Bioinformatics Tool for H4/h Antibody (H00008365-M01)

Discover related pathways, diseases and genes to H4/h Antibody (H00008365-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on H4/h

There are no specific blogs for H4/h, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H4/h Antibody (6D4) and receive a gift card or discount.


Bioinformatics

Gene Symbol HIST1H4H
Entrez
OMIM
Uniprot