Home » H4/h » H4/h Antibodies » H4/h Antibody (6D4)

H4/h Antibody (6D4)

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: H4/h Antibody (6D4) [H00008365-M01] - Analysis of monoclonal antibody to HIST1H4H on HeLa cell. Antibody concentration 10 ug/ml.
Immunocytochemistry/ Immunofluorescence: H4/h Antibody (6D4) [H00008365-M01] - Analysis of monoclonal antibody to HIST1H4H on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: H4/h Antibody (6D4) [H00008365-M01] - Detection limit for recombinant GST tagged HIST1H4H is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF, S-ELISA
Clone
6D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

H4/h Antibody (6D4) Summary

Immunogen
HIST1H4H (NP_003534, 31 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Specificity
HIST1H4H - histone 1, H4h
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HIST1H4H
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H4/h Antibody (6D4)

  • H4 histone family, member H
  • H4/A
  • H4/B
  • H4/C
  • H4/D
  • H4/E
  • H4/h
  • H4/I
  • H4/J
  • H4/K
  • H4/M
  • H4/N
  • H4/O
  • H4F2
  • H4FA
  • H4FB
  • H4FC
  • H4FD
  • H4FE
  • H4FG
  • H4FHH4/G
  • H4FI
  • H4FJ
  • H4FK
  • H4FM
  • H4FN
  • H4FO
  • HIST1H4A
  • HIST1H4B
  • HIST1H4C
  • HIST1H4D
  • HIST1H4E
  • HIST1H4F
  • HIST1H4I
  • HIST1H4J
  • HIST1H4K
  • HIST1H4L
  • HIST2H4
  • HIST2H4A
  • HIST2H4B
  • HIST4H4
  • histone 1, H4h
  • histone cluster 1, H4h
  • histone H4

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
HDAC9 Antibody
NBP2-03993
Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Review)
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
HDAC1 Antibody
NB100-56340
Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.
Immunohistochemistry-Paraffin: HDAC1 Antibody [NB100-56340] - Human testis using HDAC1 antibody at 1:250 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.
(2 Reviews)
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
H2A Antibody
NBP1-58095
Western Blot: H2A Antibody [NBP1-58095] - Jurkat cell lysate, concentration 2.5 ug/ml.
Species: Hu
Applications: WB
Histone H2a
Antibody
NB100-56346
Western Blot: Histone H2a Antibody [NB100-56346] - Histone H2A in MCF-7 and HCT-116 cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Histone H2a Antibody [NB100-56346] - Human breast probed with Histone H2A antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Western Blot: Histone H2a Antibody [NB100-56346] - Analysis of Histone H2A in human PBMC lysate probed with Histone H2A antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
KAT3B/p300
Antibody (RW105)
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B/p300 Antibody (RW105) NB100-616 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(9 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
SETD8 Antibody
NBP1-91269
Western Blot: SETD8 Antibody [NBP1-91269] - Analysis of SETD8 in whole cell lysates of mouse proliferating neural progenitors (P) and differentiating neural stem cell (D) using anti-SETD8 antibody. Image from verified customer review.
Western Blot: SETD8 Antibody [NBP1-91269] - Western blot analysis of SETD8 in Lane 1. SETD8 overexpression vector containing C-terminal DDK tag. Lane 2. Empty vector.
(2 Reviews)
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 monoclonal antibody (M01), clone 4E10-2D2 Analysis of PRDX2 expression in Hela.
Immunocytochemistry/Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration 1 ug/ml.
(1 Review)
(6 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
Airway
Trypsin-like Protease ...
MAB2695
Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (337029)
(1 Publication)
Species: Hu
Applications: WB
Sir2.1 Antibody
NB100-1923
Western Blot: Sir2.1 Antibody [NB100-1923] - Western blot using NB100-1923 against His tagged SIR-2.1 full-length protein.
(1 Review)
(2 Publications)
Species: Ce
Applications: WB, IHC, IHC-P, IP
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ChIP, IP
Histone
Deacetylase 2/HDAC2 A ...
NBP2-67451
Western Blot: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Analysis of HDAC2 on different lysates using anti-HDAC2 antibody at 1/1,000 dilution. Positive control: Lane 1: 293T Lane 2: K562
Immunocytochemistry/Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Staining HDAC2 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Analysis of paraffin-embedded rat spinal cord tissue using anti-HDAC2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
HDAC3 Antibody
NB100-1669
Western Blot: HDAC3 Antibody [NB100-1669] - Analysis of HDAC3 in HeLa cell lysate with anti-HDAC3 this antibody.
Immunocytochemistry/Immunofluorescence: HDAC3 Antibody [NB100-1669] - HDAC3 preferably binds to nuclear Htt with long Qs. HDAC3 associates exclusively with nuclear inclusion bodies. E3 or N3 cells were fixed and stained with anti-HDAC3 antibodies and visualized by Alexa 546 conjugated secondary antibodies. Arrowheads: inclusion bodies with no HDAC3 signals associated. Arrows: HDAC3 signal-associated inclusion bodies. Bar?=?20 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0111277), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: HDAC3 Antibody [NB100-1669] - Analysis human colon cancer using 1:50 conc. of HDAC3 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining of HDAC3 was observed. Staining was performed by Histowiz.
(7 Publications)
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
MYST1 Antibody
(JG36-05)
NBP2-76844
Immunocytochemistry/Immunofluorescence: MYST1 Antibody (JG36-05) [NBP2-76844] - ICC staining KAT8 in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: MYST1 Antibody (JG36-05) [NBP2-76844] - Immunohistochemical analysis of paraffin-embedded rat cervix tissue using anti-KAT8 antibody. Counter stained with hematoxylin.
Flow Cytometry: MYST1 Antibody (JG36-05) [NBP2-76844] - Flow cytometric analysis of K562 cells with KAT8 antibody at 1/100 dilution (yellow) compared with an unlabelled control (cells without incubation with primary antibody; purple).Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TIP60 Antibody
NBP2-24613
Western Blot: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in human brain lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain and 4) rat brain lysate using this antibody. 25 ug/ml.
Immunohistochemistry-Paraffin: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Simple Western: TIP60 Antibody [NBP2-24613] - Simple Western lane view shows a specific band for TIP60 in 0.2 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.
Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody
Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody
(1 Publication)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H4/h Antibody (6D4)
H00008365-M01
H4/h Antibody (6D4)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA

Publications for H4/h Antibody (H00008365-M01) (0)

There are no publications for H4/h Antibody (H00008365-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H4/h Antibody (H00008365-M01) (0)

There are no reviews for H4/h Antibody (H00008365-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for H4/h Antibody (H00008365-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional H4/h Products

Array H00008365-M01

Bioinformatics Tool for H4/h Antibody (H00008365-M01)

Discover related pathways, diseases and genes to H4/h Antibody (H00008365-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on H4/h

There are no specific blogs for H4/h, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H4/h Antibody (6D4) and receive a gift card or discount.


Bioinformatics

Gene Symbol HIST1H4H
Entrez
OMIM
Uniprot