Recombinant Human SUV3L1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SUV3L1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 687-786 of Human SUPV3L1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKATEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKKKEPDSD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SUPV3L1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SUV3L1 Protein

  • ATP-dependent RNA helicase SUPV3L1, mitochondrial
  • EC 3.6.1
  • EC 3.6.4.13
  • suppressor of var1 (S.cerevisiae) 3-like 1
  • Suppressor of var1 3-like protein 1
  • suppressor of var1, 3-like 1 (S. cerevisiae)
  • SUV3-like protein 1
  • SUV3suppressor of var1, 3-like 1(SUV3)

Background

SUPV3L1 - suppressor of var1, 3-like 1 (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-59672
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-88331
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6799
Species: Hu
Applications: WB, IHC
NB110-37258
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for SUV3L1 Partial Recombinant Protein (H00006832-Q01) (0)

There are no publications for SUV3L1 Partial Recombinant Protein (H00006832-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUV3L1 Partial Recombinant Protein (H00006832-Q01) (0)

There are no reviews for SUV3L1 Partial Recombinant Protein (H00006832-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUV3L1 Partial Recombinant Protein (H00006832-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SUV3L1 Products

Bioinformatics Tool for SUV3L1 Partial Recombinant Protein (H00006832-Q01)

Discover related pathways, diseases and genes to SUV3L1 Partial Recombinant Protein (H00006832-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUV3L1 Partial Recombinant Protein (H00006832-Q01)

Discover more about diseases related to SUV3L1 Partial Recombinant Protein (H00006832-Q01).
 

Pathways for SUV3L1 Partial Recombinant Protein (H00006832-Q01)

View related products by pathway.

Blogs on SUV3L1

There are no specific blogs for SUV3L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SUV3L1 Antibody
NBP2-34047

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SUV3L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SUPV3L1