Pannexin-1 Antibody

Images

 
Western Blot: Pannexin-1 Antibody [NBP1-92241] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PANX1 antibody. Remaining relative intensity is presented. ...read more
Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pannexin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PANX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pannexin-1 Protein (NBP1-92241PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pannexin-1 Antibody

  • Innexin
  • MGC21309
  • MRS1
  • MRS1innexin
  • pannexin 1
  • Pannexin1
  • Pannexin-1
  • PANX1
  • PX1
  • UNQ2529

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32470
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P
MAB7088
Species: Hu
Applications: WB
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB8169
Species: Hu
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92241
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Pannexin-1 Antibody (NBP1-92241) (0)

There are no publications for Pannexin-1 Antibody (NBP1-92241).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pannexin-1 Antibody (NBP1-92241) (0)

There are no reviews for Pannexin-1 Antibody (NBP1-92241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pannexin-1 Antibody (NBP1-92241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pannexin-1 Products

Bioinformatics Tool for Pannexin-1 Antibody (NBP1-92241)

Discover related pathways, diseases and genes to Pannexin-1 Antibody (NBP1-92241). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pannexin-1 Antibody (NBP1-92241)

Discover more about diseases related to Pannexin-1 Antibody (NBP1-92241).
 

Pathways for Pannexin-1 Antibody (NBP1-92241)

View related products by pathway.

PTMs for Pannexin-1 Antibody (NBP1-92241)

Learn more about PTMs related to Pannexin-1 Antibody (NBP1-92241).

Blogs on Pannexin-1

There are no specific blogs for Pannexin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pannexin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PANX1
Entrez