SUR1 Antibody

Images

 
Western Blot: SUR1 Antibody [NBP1-59778] - 293T cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: SUR1 Antibody [NBP1-59778] - Human small intestine tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, RbSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUR1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ABCC8(ATP-binding cassette, sub-family C (CFTR/MRP), member 8) The peptide sequence was selected from the N terminal of ABCC8. Peptide sequence PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Canine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCC8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ABCC8 and was validated on Western blot.
Control
Human Adrenal Whole Tissue Lysate (Adult Whole Diabetes)
Publications
Read Publication using NBP1-59778.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SUR1 Antibody

  • ABC36
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 8
  • HHF1Sulfonylurea receptor 1
  • HI
  • PHHIHRINS
  • sulfonylurea receptor (hyperinsulinemia)
  • SUR1MRP8
  • SURATP-binding cassette transporter sub-family C member 8
  • TNDM2ATP-binding cassette sub-family C member 8

Background

ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76944
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-207
Species: Hu, Mu, Ce
Applications: WB, IHC, IHC-P, IP
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP3-03965
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-22403
Species: Mu, Rt
Applications: WB, ICC/IF, IHC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB200-337
Species: Hu, Mu
Applications: WB (-), ChIP, IP
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-33144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC

Publications for SUR1 Antibody (NBP1-59778)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SUR1 Antibody (NBP1-59778) (0)

There are no reviews for SUR1 Antibody (NBP1-59778). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUR1 Antibody (NBP1-59778) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SUR1 Products

Array NBP1-59778

Bioinformatics Tool for SUR1 Antibody (NBP1-59778)

Discover related pathways, diseases and genes to SUR1 Antibody (NBP1-59778). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUR1 Antibody (NBP1-59778)

Discover more about diseases related to SUR1 Antibody (NBP1-59778).
 

Pathways for SUR1 Antibody (NBP1-59778)

View related products by pathway.

PTMs for SUR1 Antibody (NBP1-59778)

Learn more about PTMs related to SUR1 Antibody (NBP1-59778).
 

Research Areas for SUR1 Antibody (NBP1-59778)

Find related products by research area.

Blogs on SUR1

There are no specific blogs for SUR1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC8
Uniprot