Suppression of Tumorigenicity 7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ST7/LRP12 Antibody [NBP1-84772] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: ST7/LRP12 Antibody [NBP1-84772] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Suppression of Tumorigenicity 7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: THQFPELMGVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ST7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Suppression of Tumorigenicity 7 Recombinant Protein Antigen (NBP1-84772PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Suppression of Tumorigenicity 7 Antibody - BSA Free

• DKFZp762O2113
• ETS7q
• FAM4A
• FAM4A1
• family with sequence similarity 4, subfamily A, member 1
• HELG
• RAY1
• SEN4
• suppression of tumorigenicity 7 (breast)
• suppressor of tumorigenicity 7 protein
• TSG7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST7