SUMO Activating Enzyme E1 (SAE1) Antibody


Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining in human testis and pancreas tissues using anti-SAE1 antibody. Corresponding SAE1 RNA-seq data are presented for the same more
Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SUMO Activating Enzyme E1 (SAE1) Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKV DTEDIEKKPESFFTQFDAVCLTCCSRD
Specificity of human SUMO Activating Enzyme E1 (SAE1) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
SUMO Activating Enzyme E1 (SAE1) Protein (NBP2-13273PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SUMO Activating Enzyme E1 (SAE1) Antibody

  • AOS1
  • AOS1activator of SUMO1
  • FLJ3091
  • HSPC140
  • SAE1
  • SUA1
  • SUA1sentrin/SUMO-activating protein AOS1
  • SUMO Activating Enzyme E1 (SAE1/UBA2)
  • SUMO-1 activating enzyme E1 N subunit
  • SUMO1 activating enzyme subunit 1
  • SUMO-1 activating enzyme subunit 1
  • SUMO-activating enzyme subunit 1
  • UBA2
  • Ubiquitin-like 1-activating enzyme E1A
  • ubiquitin-like protein SUMO-1 activating enzyme
  • UBLE1A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P, Micro
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273) (0)

There are no publications for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273) (0)

There are no reviews for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SUMO Activating Enzyme E1 (SAE1) Products

Bioinformatics Tool for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273)

Discover related pathways, diseases and genes to SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273)

Discover more about diseases related to SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273).

Pathways for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273)

View related products by pathway.

PTMs for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273)

Learn more about PTMs related to SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273).

Research Areas for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273)

Find related products by research area.

Blogs on SUMO Activating Enzyme E1 (SAE1)

There are no specific blogs for SUMO Activating Enzyme E1 (SAE1), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SUMO Activating Enzyme E1 (SAE1) Antibody and receive a gift card or discount.


Gene Symbol SAE1