SUMO Activating Enzyme E1 (SAE1) Antibody

Images

 
Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13272] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUMO Activating Enzyme E1 (SAE1) Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAK LDSSETTMVKKKVVFCPVKEALE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
SUMO Activating Enzyme E1 (SAE1) Protein (NBP2-13272PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUMO Activating Enzyme E1 (SAE1) Antibody

  • AOS1
  • AOS1activator of SUMO1
  • FLJ3091
  • HSPC140
  • SAE1
  • SUA1
  • SUA1sentrin/SUMO-activating protein AOS1
  • SUMO Activating Enzyme E1 (SAE1/UBA2)
  • SUMO-1 activating enzyme E1 N subunit
  • SUMO1 activating enzyme subunit 1
  • SUMO-1 activating enzyme subunit 1
  • SUMO-activating enzyme subunit 1
  • UBA2
  • Ubiquitin-like 1-activating enzyme E1A
  • ubiquitin-like protein SUMO-1 activating enzyme
  • UBLE1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24651
Species: Hu, Mu, Eq, Pm
Applications: WB
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272) (0)

There are no publications for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272) (0)

There are no reviews for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUMO Activating Enzyme E1 (SAE1) Products

Bioinformatics Tool for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272)

Discover related pathways, diseases and genes to SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272)

Discover more about diseases related to SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272).
 

Pathways for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272)

View related products by pathway.

PTMs for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272)

Learn more about PTMs related to SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272).
 

Research Areas for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13272)

Find related products by research area.

Blogs on SUMO Activating Enzyme E1 (SAE1)

There are no specific blogs for SUMO Activating Enzyme E1 (SAE1), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUMO Activating Enzyme E1 (SAE1) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAE1
Entrez